Friendly psc

Friendly psc смотреть последние обновления за сегодня на .

ഒറ്റക്ലാസിൽ SCERT മലയാളസാഹിത്യം #മലയാള സാഹിത്യംകേരള PSC classes by Friendly PSC #SCERT#pscsahithyam

81372
2279
148
02:19:39
15.01.2022

#ഒറ്റക്ലാസിൽ SCERT മലയാളസാഹിത്യം #മലയാള സാഹിത്യംകേരള PSC classes by Friendly PSC #SCERT#pscsahithyam #malayalamthoolikanamam #malayalamaparanaamam #malayalamkrithikal #malayalamkadhapathramkridikal 1. പദശുദ്ധി😊 🤍 2. വാക്യ ശുദ്ധി😊 🤍 3. പരിഭാഷ😊 🤍 4. ഒറ്റപദം😊 🤍 5. പര്യായം 😊🤍 6. വിപരീതപദം😊 🤍 7. ൈശലികൾ പഴഞ്ചൊല്ലുകൾ 🤍 8. സമാനപദം 🤍 9. ചേർത്തെഴുതുക 🤍 10. സ്ത്രീലിംഗം പുല്ലിംഗം 🤍 11. വചനം 🤍 12. പിരിച്ചെഴുത്ത് 🤍 13. ഘടക പദം (വാക്യം ചേർത്തെഴുതുക) #ldcmalayalam #keralapscmalayalamclass #ldcmalayalamsyllabus #pirichezhuthu #malayalamkeralapscclass #malayala sahithyam for tenth level exam kerala psc #malayala sahithyam for twelfth level kerala psc exam #malayala sahityam for degree level kerala psc exam. #cpomalayalamsahithyam #degreelevelmalayalamsahithyam #twelfthlevelmalayalamsahithyam #tenthlevelmalayalmsahithyam #malayalamsahithyamkeralapsc #പ്രാചീനമലയാളസാഹിത്യം എഴുത്തച്ഛനു മുൻപുള്ള കാലത്തെ മലയാള സാഹിത്യത്തെയാണ് പ്രാചീന മലയാളസാഹിത്യം എന്ന് വീക്ഷിക്കുന്നത്. പ്രാചീനകാലത്തിൽ, കരിന്തമിഴിൽ സംസ്കൃതം കലർന്ന ഒരു മിശ്രഭാഷയായിട്ടായിരുന്നു മലയാളം നിലനിന്നിരുന്നത്.ഏ.ആർ രാജരാജവർമ പ്രാചീന മലയാളകാലത്തെ കരിന്തമിഴ്കാലമെന്നും മലയാണ്മക്കാലമെന്നും രണ്ടായി വിഭജിച്ചിരിക്കുന്നു. #കരിന്തമിഴ് കാലം പഴന്തമിഴിന്റെ അതിപ്രസരമുള്ള കാലഘട്ടമാണ് കരിന്തമിഴ് കാലം. '#രാമചരിതം' എന്ന കൃതിക്ക് മുൻപുള്ള കാലഘട്ടമാണിത് #മലയാണ്മക്കാലം പഴന്തമിഴിൽ നിന്ന് വേറിട്ട് മലയാളം സ്വതന്ത്രഭാഷയായി രൂപപ്പെട്ടുതുടങ്ങിയ കാലഘട്ടമാണിത്. ഇവിടം മുതലാണ് ഒരുവിധം വ്യക്തമായ മലയാളസാഹിത്യചരിത്രം ആരംഭിക്കുന്നത്. ' രാമചരിത'ത്തിന്റെ രചനാകാലമാണിത് മാധവപ്പണിക്കർ, ശങ്കരപ്പണിക്കർ, രാമപ്പണിക്കർ എന്നിവരാണ് നിരണം കവികൾ എന്നറിയപ്പെട്ടു പോരുന്നത് ക്ലാസിക്കൽ കാലഘട്ടം ചെറുശ്ശേരിനമ്പൂതിരിയുടെ കൃഷ്ണഗാഥ മലയാളസാഹിത്യത്തിന്റെ ക്ലാസിക്കൽ കാലഘട്ടത്തിന് തുടക്കം കുറിച്ചു എന്ന് പറയാം. കിളിപ്പാട്ട് പ്രസ്ഥാനത്തിന്റെ ഉപജ്ഞാതാവായ എഴുത്തച്ഛന്റെ പ്രധാന കൃതികൾ മഹാഭാരതം കിളിപ്പാട്ട്, അദ്ധ്യാത്മരാമായണം കിളിപ്പാട്ട്, ഇരുപത്തിനാലുവൃത്തം, #ഹരിനാമകീർത്തനം എന്നിവയാണ്. #പൂന്താനത്തിന്റെ #ജ്ഞാനപ്പാന'യും കീർത്തനങ്ങളും ഭക്തിപ്രസ്ഥാനത്തിന് ശക്തിപകർന്നു. ഉണ്ണായിവാര്യർ, കോട്ടയത്തു തമ്പുരാൻ, ഇരയിമ്മൻ തമ്പി തുടങ്ങിയവരുടെ ആട്ടക്കഥകളും മലയാളസാഹിത്യത്തെ പോഷിപ്പിച്ചു. തുള്ളൽ പ്രസ്ഥാനത്തിന്റെ വ്യവസ്ഥാപകനായ കുഞ്ചൻ നമ്പ്യാർ പതിനെട്ടാം നൂറ്റാണ്ടിലെ മലയാളഭാഷയെയും സാഹിത്യത്തെയും ഫലിതപ്രധാനമായ ആഖ്യാനശൈലിയാൽ സമ്പുഷ്ടമാക്കി. കുചേലവൃത്തം വഞ്ചിപ്പാട്ടെന്ന ഒറ്റ കൃതികൊണ്ടുതന്നെ രാമപുരത്തു വാര്യർ മലയാള സാഹിത്യചരിത്രത്തിൽ ചിരപ്രതിഷ്ഠ നേടി #ആധുനികകാലഘട്ടം പദ്യസാഹിത്യത്തോടൊപ്പംതന്നെ ഗദ്യസാഹിത്യവും ശക്തിപ്രാപിച്ച കാലഘട്ടമാണിത്. സാഹിത്യം, വ്യാകരണം എന്നിവയിൽ കേരളവർമ വലിയകോയിത്തമ്പുരാൻ, എ.ആർ. രാജരാജവർമ തുടങ്ങിയവരുടെ സംഭാവനകൾ വളരെ മഹത്തരമാണ്. #വേങ്ങയിൽകുഞ്ഞിരാമൻ നായനാരുടെ #വാസനാവികൃതിയാണ് മലയാളത്തിലെ #ആദ്യചെറുകഥ. ഒ. ചന്തുമേനോന്റെ 'ഇന്ദുലേഖ' എന്ന നോവലാണ് മലയാളത്തിലെ ആദ്യത്തെ ലക്ഷണമൊത്ത നോവൽ ആത്മകഥകൾ . ജോസഫ് മുണ്ടശ്ശേരിയുടെ ആത്മകഥയാണ് കൊഴിഞ്ഞ ഇലകൾ. എന്റെ കഥ' കമല സുറയ്യയുടേതാണ്. ' കണ്ണീരും കിനാവും'( വി ടി ഭട്ടതിരിപ്പാട്), 'ഓർമ്മയുടെ അറകൾ'(ബഷീർ), 'ആത്മകഥ' (ഇ എം എസ് ‌) എന്നിവ മലയാളത്തിലെ പ്രധാന ആത്മകഥകളാണ്. Malayalam syllabus wise classes for Kerala psc preliminary exam 12th and degree level. #1 padasudhi #2 vakyasudhi #3 paribhasha #4 ottapadam #5paryayam #6vipareedam #7shailikal and pazhamchollu #8 samanapadam #9 cherthezhuthu #10 streelimgam pullimgam #11vachanam #12pirichezhuthu #13khadakapadam (vakyam cherthezhuthu) #scertmalayalamclassstd3 #scertmalayalamclassstd4 #scertmalayalamclassstd5 #scertmalayalamclassstd6 #scertmalayalamclassstd7 #scertmalayalamclassstd8 #scertmalayalamclassstd9 #scertmalayalamclassstd10 #malayalamkavikal #keralapscmalayalamsahithyam #keralapscmalayalamwritters kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam #malayalamclassforkeralapscstudents #malayalamsahithyamforschoolstudents #malayalamsahithyamforktet #Ktetexammalayalam #Ktetexammalayalamsahithyam #Ktetexamclass #malayalam class for Ktet exam #sahithyacharithram #sahithyampreviousquestionkeralapsc #keralapscmalayalampreviousquestion #previous question kerala psc malayalam #malayalam kadhapathram krithikal #malayalam kavi vakyamgal #malayalam sahithyam for kerala psc exams #malayalam syllabus kerala psc #kerala psc malayalam full class #malayalam kerala psc fullsyllabus based class malayalam class for USS exam malayalam class for all psc exams The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

LDC മലയാളം സിലബസിലെ മുഴുവൻ ക്ലാസുകളും Degree level CPO malayalam #ldcmalayalamfullsyllabus #psc

156373
5998
447
04:18:19
18.11.2021

LDC മലയാളം സിലബസിലെ മുഴുവൻ ക്ലാസുകളും Degree level CPO malayalam #ldcmalayalamfullsyllabus #psc ശിഥില വർണങ്ങൾ 🤍 1. പദശുദ്ധി😊 🤍 2. വാക്യ ശുദ്ധി😊 🤍 3. പരിഭാഷ😊 🤍 4. ഒറ്റപദം😊 🤍 5. പര്യായം 😊🤍 6. വിപരീതപദം😊 🤍 7. ൈശലികൾ പഴഞ്ചൊല്ലുകൾ 🤍 8. സമാനപദം 🤍 9. ചേർത്തെഴുതുക 🤍 10. സ്ത്രീലിംഗം പുല്ലിംഗം 🤍 11. വചനം 🤍 12. പിരിച്ചെഴുത്ത് 🤍 13. ഘടക പദം (വാക്യം ചേർത്തെഴുതുക) #ldcmalayalam #keralapscmalayalamclass #ldcmalayalamsyllabus #pirichezhuthu #malayalamkeralapscclass The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

SCERT full മലയാളം വെക്കാബുലറി #LDC #CPO #ldc #degreelevel SCERT malayalam full class

79217
2618
162
01:55:03
28.12.2021

SCERT full മലയാളം റിവിഷൻ #typist #CPO #ldc #malayalam class for all psc exams മലയാളം ക്ലാസുകൾ playlist നോക്കി വേണ്ടതു കാണുക scert malayalam class #pscmalayalam #cpo malayalam #keralapsc malayalam #degreelevel SCERT malayalam full class #ldtypistkeralapsc #ldtypist #typist Kerala psc LDC മലയാളം സിലബസിലെ മുഴുവൻ ക്ലാസുകളും Degree level CPO malayalam #ldcmalayalamfullsyllabus #psc ശിഥില വർണങ്ങൾ 🤍 1. പദശുദ്ധി😊 🤍 2. വാക്യ ശുദ്ധി😊 🤍 3. പരിഭാഷ😊 🤍 4. ഒറ്റപദം😊 🤍 5. പര്യായം 😊🤍 6. വിപരീതപദം😊 🤍 7. ൈശലികൾ പഴഞ്ചൊല്ലുകൾ 🤍 8. സമാനപദം 🤍 9. ചേർത്തെഴുതുക 🤍 10. സ്ത്രീലിംഗം പുല്ലിംഗം 🤍 11. വചനം 🤍 12. പിരിച്ചെഴുത്ത് 🤍 13. ഘടക പദം (വാക്യം ചേർത്തെഴുതുക) #ldcmalayalam #keralapscmalayalamclass #ldcmalayalamsyllabus #pirichezhuthu #malayalamkeralapscclass kerala psc malayalam class. നമ്മുടെ friendly psc യിൽ എടുത്തിട്ടുള്ള മുഴുവൻ ക്ലാസ്സുകളും ഉൾപ്പെടുത്തിക്കൊണ്ടുള്ള playlist ആണ് ഇത്. ചാനലിൽ എടുത്തിട്ടുള്ള എല്ലാ ക്ലാസുകളും കാണാൻ ആഗ്രഹമുള്ള കൂട്ടുകാർക്ക് ഇത് പ്രയോജനപ്പെടും. ഇനി പ്രത്യേക വിഷയങ്ങൾ മാത്രം കാണാൻ ആഗ്രഹിക്കുന്നവർക്കായി subject wise playlist ഉം നമ്മൾ ശരിയാക്കിയിട്ടുണ്ട്. eg-Kerala psc malayalam grammar ,vocabulary എന്ന playlist ൽ നമ്മൾ ചെയ്തിരിക്കുന്ന മുഴുവൻ മലയാളം ക്ലാസ്സുകളും ലഭിക്കും Kerala psc malayalam previous questions solved paper എന്ന playlist ൽ മലയാളത്തിലെ നമ്മൾ ചെയ്ത മുൻകാല ചോദ്യങ്ങൾ ലഭിക്കും Kerala psc ldc malayalam class എന്ന playlist ൽ LDC സിലബസ് പ്രകാരം നമ്മൾ ചെയ്ത എല്ലാ ക്ലാസുകളും ലഭിക്കും kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam malayalam bhedakam malayalam dyodakam malayalam vachanam malayalam vibhakthi malayalam kriya malayalam pattuvina malauyalam muttuvina malayalam samaasam kerala psc english vocabulary kerala psc english collective noun kerala psc english animal young one kerala psc animal sound kerala psc question tag english kerala psc english phrasal verb with code kerala psc prepositions kerala psc phrasal verbs kerala psc science class eye kerala psc science human body kerala psc science atom kerala psc periodic table class kerala psc Newtons law of motion kerala psc science properties of light kerala psc properties of matter kerala psc river kerala psc kerala related facts kerala psc india related facts kerala psc online class friendly psc kerala psc constitution class kerala psc indian river kerala psc kerala river kerala psc malayalam sahithyam kerala psc malayalam poets kerala psc online free class kerala psc online class for students free kerala psc class #friendlypsc malayalam online class for kerala psc simple kerala psc class kerala psc classes for beginners kerala psc science class for beginners kerala psc science class for ldc exam kerala psc science class for uniform post kerala psc science class for secretariat assistant kerala psc class for preliminary exam kerala psc class for twelfth prelims kerala psc class for BDO exam kerala psc class for VEO kerala psc class for secretariat assistant This playlist contains many online psc classes.Kerala psc exam online classes of subjects like kerala psc malayalam grammar,kerala psc malayalam vocabulary,Kerala psc science classes,kerala psc english vocabulary,kerala psc english grammar ,kerala psc ldc classes,kerala psc tenth level preliminary exams,kerala psc tenth level syllabus wise classes,kerala psc plus two level syllabus wise classes, kerala psc degree level syllabus wise classes,kerala psc secretariat exam syllabus wise classes,kerala psc lpup assistant syllabus wise classes,kerala psc fireman and police exam syllabus wise classes ,All uniform post kerala psc exam syllabus wise classes are included in this play list. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

1#പദശുദ്ധി #malayalam PADASUDHI #MALAYALAM CLASS#LDC #DEGREELEVEL #PSC Kerala PSC Friendly PSC

90340
4911
203
00:11:45
12.08.2021

1#പദശുദ്ധി #malayalam PADASUDHI #ldc #policeexam #uniformpost exams # 1. പദശുദ്ധി 🤍 2. വാക്യ ശുദ്ധി 🤍 3. പരിഭാഷ😊🤍 4. ഒറപദം 5. പര്യായം 6. വിപരീത പദം 7. ൈശലികൾ പഴഞ്ചൊല്ലുകൾ 8. സമാനപദം 9. ചേർത്തെഴുതുക 10. സ്ത്രീലിംഗം പുല്ലിംഗം 11. വചനം 12. പിരിച്ചെഴുത്ത് 13. ഘടക പദം (വാക്യം ചേർത്തെഴുതുക) #MALAYALAM CLASS#LDC #DEGREELEVEL #PSC Kerala PSC Friendly PSC PADASUDHI #MALAYALAM CLASS#LDC #DEGREELEVEL #PSC Kerala PSC Friendly PSC Malayalam PSC pada sudhi previous question, മലയാളം പദശുദ്ധി PSC .Tricky psc class .Tricks to remember malayalam.PSC മലയാളം വ്യാകരണം This video containes previous psc questions from malayalam pada sudhi. #മലയാളംപദശുദ്ധി #മലയാളംവാക്യശുദ്ധി # #മലയാളംപദപ്രയോഗം #ഡിഗ്രിലെവൽ മലയാളം #മലയാളംതെറ്റുകൾ #മലയാളം പ്ലസ്ടുലെവൽകേരളPSC psc coaching class malayalam #malayalampadasushi #ldcmalayalamclass #universityassistantmalayalamclass #universityassistantmalayalamgrammar #veomalayalam #veopscclass #ldcmalayalamclass #universityassistantpscclass #keralapscmalayalam #malayalamgrammar #pscmalayalamgrammar #malayalampscclass #pscmalayalanclass #pscmalayalam #pscmalayalamgrammarnaamam,this video is a well explained and tricky class of malayalam for Kerala PSC students, #kerala psc|#malayalam grammar #മലയാളം വ്യാകരണം #pscmalayalamgrammarclass,#pscmalyalamvibakthiclass #keralapscmalayalamgrmmar #keralapscmalayalamclasa #kerala psc malayalam class #veryusefulmalayalamgrammarclass #psccoachingclassmalayalam The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#29 #ആസിഡ് #acid #pscshorts #acid #acid and base #educational entertainment #keralapscshorts

1512135
89138
265
00:00:58
16.12.2021

#29 # ആസിഡ് #tartaric acid #shorts #acidmemorytrick #keralapscscience #കേരളാ PSC #shorts #ടാർട്ടാറിക്ആസിഡ് #ഫോമിക്കാസിഡ് #tartaricacid #ആസിഡും ആൽക്കലിയും #scertscience #scienceshorts #funnyscience video #funnypsc video #funnypsc #psccomedy video #comedysciencevideo #acid comedy #tartaric acid comedy Acetic Acid -Vinegar Malic- AcidApple Oxalic Acid-Tea, Cocoa, Pepper Tannic Acid-Tea Tartric Acid-Grapes, Pineapples, Potatoes, Carrots The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the topic friendly psc യിൽ എടുത്തിട്ടുള്ള മുഴുവൻ ക്ലാസ്സുകളും ഉൾപ്പെടുത്തിക്കൊണ്ടുള്ള playlist ആണ് ഇത്. ചാനലിൽ എടുത്തിട്ടുള്ള എല്ലാ ക്ലാസുകളും കാണാൻ ആഗ്രഹമുള്ള കൂട്ടുകാർക്ക് ഇത് പ്രയോജനപ്പെടും. ഇനി പ്രത്യേക വിഷയങ്ങൾ മാത്രം കാണാൻ ആഗ്രഹിക്കുന്നവർക്കായി subject wise playlist ഉം നമ്മൾ ശരിയാക്കിയിട്ടുണ്ട്. eg-Kerala psc malayalam grammar ,vocabulary എന്ന playlist ൽ നമ്മൾ ചെയ്തിരിക്കുന്ന മുഴുവൻ മലയാളം ക്ലാസ്സുകളും ലഭിക്കും Kerala psc malayalam previous questions solved paper എന്ന playlist ൽ മലയാളത്തിലെ നമ്മൾ ചെയ്ത മുൻകാല ചോദ്യങ്ങൾ ലഭിക്കും Kerala psc ldc malayalam class എന്ന playlist ൽ LDC സിലബസ് പ്രകാരം നമ്മൾ ചെയ്ത എല്ലാ ക്ലാസുകളും ലഭിക്കും kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam malayalam bhedakam malayalam dyodakam malayalam vachanam malayalam vibhakthi malayalam kriya malayalam pattuvina malauyalam muttuvina malayalam samaasam kerala psc english vocabulary kerala psc english collective noun kerala psc english animal young one kerala psc animal sound kerala psc question tag english kerala psc english phrasal verb with code kerala psc prepositions kerala psc phrasal verbs kerala psc science class eye kerala psc science human body kerala psc science atom kerala psc periodic table class kerala psc Newtons law of motion kerala psc science properties of light kerala psc properties of matter kerala psc river kerala psc kerala related facts kerala psc india related facts kerala psc online class friendly psc kerala psc constitution class kerala psc indian river kerala psc kerala river kerala psc malayalam sahithyam kerala psc malayalam poets kerala psc online free class kerala psc online class for students free kerala psc class malayalam online class for kerala psc simple kerala psc class kerala psc classes for beginners kerala psc science class for beginners kerala psc science class for ldc exam kerala psc science class for uniform post kerala psc science class for secretariat assistant kerala psc class for preliminary exam kerala psc class for twelfth prelims kerala psc class for BDO exam kerala psc class for VEO kerala psc class for secretariat assistant This playlist contains many online psc classes.Kerala psc exam online classes of subjects like kerala psc malayalam grammar,kerala psc malayalam vocabulary,Kerala psc science classes,kerala psc english vocabulary,kerala psc english grammar ,kerala psc ldc classes,kerala psc tenth level preliminary exams,kerala psc tenth level syllabus wise classes,kerala psc plus two level syllabus wise classes, kerala psc degree level syllabus wise classes,kerala psc secretariat exam syllabus wise classes,kerala psc lpup assistant syllabus wise classes,kerala psc fireman and police exam syllabus wise classes ,All uniform post kerala psc exam syllabus wise classes are included in this play list.

#26 നീരക്ഷീരന്യായം മലയാളം ശൈലികൾ #കേരളാ PSC ശൈലികൾവേർതിരിച്ചറിയാൻകഴിയാത്തകൂട്ടിച്ചേർക്കൽ #shorts

11942189
524433
400
00:00:47
05.11.2021

#26 #നീരക്ഷീരന്യായം #കേരളാ PSC ശൈലികൾ #shorts വേർതിരിച്ചറിയാൻകഴിയാത്ത തരത്തിലുള്ളകൂട്ടിച്ചേർക്കൽ ഏടുകെട്ടുക = പഠിത്തം അവസാനിപ്പിക്കുക പണ്ടൊക്കെ പത്താം ക്ലാസു പരീക്ഷയെ ഏടുകെട്ടു പരീക്ഷ എന്ന് വിളിച്ചിരുന്നു #shorts #Keralapscshorts #keralapsc #malayalamshailikal കേരളാ PSC ശൈലികൾ ശൈലികൾ#പഴഞ്ചൊല്ല് kerala psc മലയാളം Qn14😂ഇല്ലത്തെപൂച്ച #ശൈലികൾkerala pscmalayalam #shorts youtube psc shorts malayalam#ldc #degree level #ldc malayalam class #shailikal malayalam ഇ​ല്ല​ത്തെ​ ​പൂ​ച്ച എ​വി​ടെ​യും​ ​പ്ര​വേ​ശ​ന​മു​ള്ള​യാ​ൾ.​ ​ആ​രും​ ​ത​ട​യാ​ത്ത​തി​ന്റെ​ ​സൂ​ച​കം. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the topics ഓ​രോ​ഭാ​ഷ​യ്ക്കും​ത​ന​താ​യ​ശൈ​ലി​ക​ളും​ പ്ര​യോ​ഗ​ങ്ങ​ളു​മു​ണ്ട്.​ ഭാ​ഷ​യു​ടെ​ സ​മ്പ​ത്താ​ണ​വ.​ മ​ല​യാ​ള​ ഭാ​ഷ​യു​ടെ​ പ​ദ​ശേ​ഖ​ര​ത്തി​ൽ ​ മി​ന്നി​ത്തി​ള​ങ്ങു​ന്ന​ കു​റേ​ ​ ശൈ​ലി​ക​ൾ​ പ​രി​ച​യ​പ്പെടാം. പാ​ഠ​ഭാ​ഗ​ങ്ങ​ളു​മാ​യി​ ബ​ന്ധ​പ്പെ​ട്ട് ​ ഇ​വ​ ഹൃ​ദി​സ്ഥ​മാ​ക്കു​ക friendly psc യിൽ എടുത്തിട്ടുള്ള മുഴുവൻ ക്ലാസ്സുകളും ഉൾപ്പെടുത്തിക്കൊണ്ടുള്ള playlist ആണ് ഇത്. ചാനലിൽ എടുത്തിട്ടുള്ള എല്ലാ ക്ലാസുകളും കാണാൻ ആഗ്രഹമുള്ള കൂട്ടുകാർക്ക് ഇത് പ്രയോജനപ്പെടും. ഇനി പ്രത്യേക വിഷയങ്ങൾ മാത്രം കാണാൻ ആഗ്രഹിക്കുന്നവർക്കായി subject wise playlist ഉം നമ്മൾ ശരിയാക്കിയിട്ടുണ്ട്. eg-Kerala psc malayalam grammar ,vocabulary എന്ന playlist ൽ നമ്മൾ ചെയ്തിരിക്കുന്ന മുഴുവൻ മലയാളം ക്ലാസ്സുകളും ലഭിക്കും Kerala psc malayalam previous questions solved paper എന്ന playlist ൽ മലയാളത്തിലെ നമ്മൾ ചെയ്ത മുൻകാല ചോദ്യങ്ങൾ ലഭിക്കും Kerala psc ldc malayalam class എന്ന playlist ൽ LDC സിലബസ് പ്രകാരം നമ്മൾ ചെയ്ത എല്ലാ ക്ലാസുകളും ലഭിക്കും kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam malayalam bhedakam malayalam dyodakam malayalam vachanam malayalam vibhakthi malayalam kriya malayalam pattuvina malauyalam muttuvina malayalam samaasam kerala psc english vocabulary kerala psc english collective noun kerala psc english animal young one kerala psc animal sound kerala psc question tag english kerala psc english phrasal verb with code kerala psc prepositions kerala psc phrasal verbs kerala psc science class eye kerala psc science human body kerala psc science atom kerala psc periodic table class kerala psc Newtons law of motion kerala psc science properties of light kerala psc properties of matter kerala psc river kerala psc kerala related facts kerala psc india related facts kerala psc online class friendly psc kerala psc constitution class kerala psc indian river kerala psc kerala river kerala psc malayalam sahithyam kerala psc malayalam poets kerala psc online free class kerala psc online class for students free kerala psc class malayalam online class for kerala psc simple kerala psc class kerala psc classes for beginners kerala psc science class for beginners kerala psc science class for ldc exam kerala psc science class for uniform post kerala psc science class for secretariat assistant kerala psc class for preliminary exam kerala psc class for twelfth prelims kerala psc class for BDO exam kerala psc class for VEO kerala psc class for secretariat assistant This playlist contains many online psc classes.Kerala psc exam online classes of subjects like kerala psc malayalam grammar,kerala psc malayalam vocabulary,Kerala psc science classes,kerala psc english vocabulary,kerala psc english grammar ,kerala psc ldc classes,kerala psc tenth level preliminary exams,kerala psc tenth level syllabus wise classes,kerala psc plus two level syllabus wise classes, kerala psc degree level syllabus wise classes,kerala psc secretariat exam syllabus wise classes,kerala psc lpup assistant syllabus wise classes,kerala psc fireman and police exam syllabus wise classes ,All uniform post kerala psc exam syllabus wise classes are included in this play list. അ​ന​ന്ത​ൻ​കാ​ട് പൊ​തു​വേ​ ​ഭ​യ​മു​ണ്ടാ​ക്കു​ന്ന​ ​സ്ഥ​ല​ങ്ങ​ൾ,​ ​കേ​ന്ദ്ര​ങ്ങ​ൾ​ ​എ​ന്നി​വ​യു​ടെ​ ​പ്ര​തീ​കം. അ​ടി​മു​ടി​ ​ന​ശി​പ്പി​ക്കു​ക,​ ​വേ​രോ​ടെ​ ​ഇ​ല്ലാ​താ​ക്കു​ക,​ ​ഉ​ന്മൂ​ല​ ​നാ​ശം​ ​വ​രു​ത്തു​ക​ ​എ​ന്നൊ​ക്കെ​ ​സൂ​ചി​പ്പി​ക്കു​ന്നു. ആ​കാ​ശ​ ​കു​സു​മം ഒ​രി​ക്ക​ലും​ ​സം​ഭ​വി​ക്കാ​ത്ത​ ​കാ​ര്യ​മെ​ന്ന​തി​ന്റെ​ ​സൂ​ചന ആ​കാ​ശ​ ​പു​രാ​ണം ഇ​ല്ലാ​ത്ത​തി​ന്റെ​ ​സൂ​ച​ന.​ ​അ​സ​ത്യ​മാ​യ​ ​കാ​ര്യം ​ ആ​ല​ത്തൂ​ർ​ ​കാ​ക്ക ആ​ശി​ച്ചു​ ​കാ​ലം​ ​ക​ഴി​ക്കു​ന്ന​വൻ ഇ​ല​യി​ട്ടു​ ​ച​വി​ട്ടുക അ​റി​ഞ്ഞു​കൊ​ണ്ട് ​തെ​റ്റു​ ​ചെ​യ്യു​ന്ന​തി​ന്റെ​ ​സൂ​ചന

കോഡിലൂടെ..രോഗങ്ങളുംരോഗകാരികളും #lgssyllabus #universitylgs #university assistant #ldc #diseasespsc

2088
148
22
01:40:06
28.01.2023

കോഡിലൂടെ..രോഗങ്ങളുംരോഗകാരികളും #lgssyllabus #universitylgs #university assistant #ldc #diseasespsc *നമ്മുടെ ബുക്ക് വാങ്ങാനുള്ള friendly psc website link. 🤍 *ടെലഗ്രാമിൽ join ചെയ്യൂ .. 🤍 *WhatsApp no-8921519536 #keralapsc science class * ജലത്തിലൂടെ പകരുന്ന രോഗങ്ങൾ -കോളറ,ടൈഫോയിഡ പോളിയോ മൈലറ്റിസ്എലിപ്പനി,ഹൈപ്പറ്റൈറ്റിസ് വയറുകടി *പ്ലേഗ് -എലിച്ചെള്ള് * ടൈഫസ് -പേന്, ചെള്ള് * കാലാ അസര് - സാന്ഡ് ഫ്ള്ളൈ * സ്ലീപ്പിങ്ങ് സിക്ക്നസ്സ് - സെ സെ ഫ്ളൈ * മന്ത് - ക്യൂലക്സ് പെണ്കൊതുകുകള് * മലേറിയ - അനോഫിലസ് പെണ്കൊതുകുകള് * മഞ്ഞപ്പനി,ഡെങ്കിപ്പനി ,ചിക്കന്ഗുനിയ- ഈഡിസ് ഈജിപ്റ്റി * ജപ്പാന് ജ്വരം - രോഗാണുവാഹകരായ പലതരം കൊതുകുകള് * STD- ഗോണോറിയ, സിഫിലിസ്,എയ്ഡ്സ് Air Borne Disease Kerala PSC വായുവിലൂടെ പകരുന്ന രോഗങ്ങൾ Kerala PSC # #രോഗങ്ങളുംരോഗകാരികളും #biologykeralapsc #keralapscscienceclass #Keralapscclass #ldcclass #veoclass A disease is a particular abnormal condition that negatively affects the structure or function of all or part of an organism, and that is not immediately due to any external injury #kerala psc science rogamgal The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#ദേവസ്വംബോർഡ് മലയാളം #previousLDC #devaswomboardclass #devaswomboardmalayalam #Friendly PSC

6321
476
63
00:12:37
03.09.2022

#ദേവസ്വംബോർഡ് മലയാളം #devaswomboardclass #devaswomboardmalayalam #Kerala PSC Friendly PSC #padanishpadanam #friendlypsc #vakyaanvayam #പദനിഷ്പാദനം Malayalam syllabus wise classes for Kerala psc preliminary exam 12th and degree level. #1 padasudhi #2 vakyasudhi #3 paribhasha #4 ottapadam #5paryayam #6vipareedam #7shailikal and pazhamchollu #8 samanapadam #9 cherthezhuthu #10 streelimgam pullimgam #11vachanam #12pirichezhuthu #13khadakapadam (vakyam cherthezhuthu) kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#ദേവസ്വംബോർഡ് മലയാളം #devaswomboardclass #devaswomboardmalayalam #Kerala PSC Friendly PSC

23126
1172
91
03:53:01
02.09.2022

#ദേവസ്വംബോർഡ് മലയാളം #devaswomboardclass #devaswomboardmalayalam #Kerala PSC Friendly PSC #padanishpadanam #friendlypsc #vakyaanvayam #പദനിഷ്പാദനം Malayalam syllabus wise classes for Kerala psc preliminary exam 12th and degree level. #1 padasudhi #2 vakyasudhi #3 paribhasha #4 ottapadam #5paryayam #6vipareedam #7shailikal and pazhamchollu #8 samanapadam #9 cherthezhuthu #10 streelimgam pullimgam #11vachanam #12pirichezhuthu #13khadakapadam (vakyam cherthezhuthu) kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

നിർമ്മാണ പ്രക്രിയ Nirmmanaprakriya kerala psc chemistry #preliminary chemistry class Friendly psc

41907
2365
591
00:21:16
30.09.2020

നിർമ്മാണ പ്രക്രിയ code ലൂടെ പഠിക്കാം Nirmmanaprakriya kerala psc chemistry #preliminary exam chemistry class Friendly psc kerala psc The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#8 #സമാനപദംSamana padam #ardham #malayalam paryayam Kerala PSC Preliminary Syllabus Friendly PSC

33100
1550
120
00:14:44
27.03.2021

#Samana padam #ardham #malayalam paryayam Kerala PSC Preliminary Syllabus wise classes Friendly PSC മലയാളം ക്ലാസ്സുകൾ ലിങ്കിൽ നോക്കൂ 🤍 🤍 #അങ്കുടം = താക്കോൽ #അഗ്രജൻ = മൂത്ത , ബ്രാഹ്മണൻ #അവരജൻ = ഇളയ , ശൂദ്രൻ #അവഗീതൻ = അവഗണിക്കപ്പെട്ടവൻ, അധമൻ #അഭിജ്ഞാനം = അടയാളം #അനുചിതം = ഉചിതമല്ലാത്ത #ആർദ്രം = നനഞ്ഞത് #ഇരവി, ഇനൻ, അർക്കൻ = സൂര്യൻ The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points. #ardham malayalam class #keralapscmalayalm #paryayammalayalam #malayalamclassforschoolstudents

സ്ത്രീകൾ ഉറപ്പായും കാണുക | Arya G & Ponnu R | എന്റെ ഗുരുനാഥൻ | Friendly PSC | GK Lovers

62456
2733
462
00:16:43
21.04.2021

വീട്ടമ്മയും ഓൺലൈൻ PSC അദ്ധ്യാപികയും സൈക്കോളജി വിദ്യാർത്ഥിനിയുമായ ആര്യ ടീച്ചറിന്റെ ജീവിതാനുഭവങ്ങൾ നിങ്ങൾക്ക് ഒരു പ്രചോദനം ആകും. തീർച്ച. മത്സരപ്പരീക്ഷകൾക്ക് തയ്യാറെടുക്കുന്ന എല്ലാ വീട്ടമ്മമാരും സ്ത്രീകളും ഉറപ്പായും ആര്യ ടീച്ചറിന്റെ ഈ ഇന്റർവ്യൂ കാണുക. PSC പരീക്ഷകൾക്ക് വേണ്ട വിവരങ്ങൾ കോഡിലൂടെ പഠിപ്പിക്കുന്ന Friendly PSC യുടെ ആര്യ ടീച്ചറിന്റെ ഷോർട് കട്ട് അനുഭവങ്ങൾ കേൾക്കാം. Friendly PSC 🤍 ❤️എന്റെ ഗുരുനാഥൻ 👇 🤍 ❤️ GK Lovers Telegram 👇 🤍 GK Lovers - Learning App It's Your Turn A dedicated platform to help Competitive Exam Aspirants to crack exams easily.Join our community, to receive free notes, Exam Analysis,Test series and lots more. GK Lovers - Learning ആപ്പിൽ ഞങ്ങൾ നൽകുന്ന സേവങ്ങൾ. 👉വിഡിയോ ക്ലാസുകൾ 👉ഓഡിയോ ക്ലാസുകൾ 👉 PDF Notes 👉SCERT ചോദ്യങ്ങൾ 🆓ആനുകാലിക വിവരങ്ങൾ 🆓മോക് ടെസ്റ്റ്‌ 🆓മൾട്ടിപ്പിൾ ചോയ്സ് ചോദ്യങ്ങൾ 🆓ക്വിസ് ചോദ്യങ്ങൾ 🆓സംശയനിവാരണത്തിനായി ഡിസ്‌കസ് GK Lovers - Learning App ഗൂഗിൾ പ്ലേ സ്റ്റോറിൽ ലഭ്യമാണ്.. ഡൗൺലോഡ് GK Lovers - Learning App 👇 🤍 ✍️✍️✍️✍️✍️✍️✍️✍️✍️✍️✍️✍️ ❤️ GK Lovers mail address 👇 teamgklovers🤍gmail.com ❤️ GK Lovers Youtube 👇 🤍 ❤️ GK Lovers Telegram 👇 🤍 ❤️ GK Lovers Telegram Discussion group 👇 🤍 ❤️ GK Lovers facebook 👇 🤍 ❤️ GK Lovers instagram 👇 🤍 ❤️ GK Lovers twitter 👇 🤍 ❤️ GK Lovers LinkedIn 👇 🤍 ❤️ വാട്സ് ആപ്പ് നമ്പർ 👇 7736184885 😍സകൂൾ കുട്ടികൾക്ക് വേണ്ടിയുള്ള നോട്ടിഫിക്കേഷനുകൾ നൽകുന്ന GK Lovers-School എന്ന ഞങ്ങളുടെ ചാനൽ ഇതാ. 👇 🤍 എന്റെ ഗുരുനാഥൻ , ente gurunadhan , GK Lovers Educators Meet, GK Lovers Edu Meet, psc motivation malayalam, psc motivation video, psc motivation class, psc motivation story malayalam, psc job motivation beginners, life is psc motivation psc motivation gk lovers, ponnu surya r, gk lovers ponnu surya r, psc job motivation, psc job motivation girls, psc job motivation for women, psc job motivation for house wife, DISCLAIMER This video doesn't contain any harmful or illegal matters. This is strictly YouTube guideline friendly. Do not try to upload these videos without our permission under any circumstances. If you do so it will violate the YouTube terms of use or have to express permission from copyright. ✍️✍️✍️✍️✍️✍️✍️✍️✍️✍️✍️✍️ Fly to Success with GK Lovers❤️ “Knowledge increases by sharing but not by saving." || GK Lovers || || GK Lovers ||

സാഹിത്യം #shorts Kerala psc Malayalam #ഉള്ളൂർ #ആധുനികകവിത്രയം

12920
625
6
00:00:27
28.10.2022

സാഹിത്യം #shorts Kerala psc Malayalam #ഉള്ളൂർ #ആധുനികകവിത്രയം

1#പദശുദ്ധി #padasudhi plus two degree preliminary exam kerala psc മലയാളംPSC Preliminary Friendly PSC

46870
2165
292
00:16:51
15.03.2021

padasudhi plus two degree preliminary exam kerala pscKerala PSC Preliminary Syllabus Friendly PSC Malayalam PSC pada sudhi previous question, മലയാളം പദശുദ്ധി PSC .Tricky psc class .Tricks to remember malayalam.PSC മലയാളം വ്യാകരണം This video containes previous psc questions from malayalam pada sudhi. #മലയാളംപദശുദ്ധി #മലയാളംവാക്യശുദ്ധി # #മലയാളംപദപ്രയോഗം #ഡിഗ്രിലെവൽ മലയാളം #മലയാളംതെറ്റുകൾ #മലയാളം പ്ലസ്ടുലെവൽകേരളPSC psc coaching class malayalam #malayalampadasushi #ldcmalayalamclass #universityassistantmalayalamclass #universityassistantmalayalamgrammar #veomalayalam #veopscclass #ldcmalayalamclass #universityassistantpscclass #keralapscmalayalam #malayalamgrammar #pscmalayalamgrammar #malayalampscclass #pscmalayalanclass #pscmalayalam #pscmalayalamgrammarnaamam,this video is a well explained and tricky class of malayalam for Kerala PSC students, #kerala psc|#malayalam grammar #മലയാളം വ്യാകരണം #pscmalayalamgrammarclass,#pscmalyalamvibakthiclass #keralapscmalayalamgrmmar #keralapscmalayalamclasa #kerala psc malayalam class #veryusefulmalayalamgrammarclass #psccoachingclassmalayalam The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#കോയിത്തമ്പുരാൻ ശൈലി വന്നകഥ #Keralapscshorts #shorts #youtubeshorts #pscmalayalam #friendlypsc

62957
3905
296
00:00:51
13.09.2022

#കോയിത്തമ്പുരാൻ ശൈലി വന്നകഥ #Keralapscshorts #shorts #youtubeshorts #pscmalayalam #friendlypsc #ഒറ്റക്ലാസിൽ SCERT മലയാളസാഹിത്യം #മലയാള സാഹിത്യംകേരള PSC classes by Friendly PSC #SCERT#pscsahithyam #malayalamthoolikanamam #malayalamaparanaamam #malayalamkrithikal #malayalamkadhapathramkridikal 1. പദശുദ്ധി😊 🤍 2. വാക്യ ശുദ്ധി😊 🤍 3. പരിഭാഷ😊 🤍 4. ഒറ്റപദം😊 🤍 5. പര്യായം 😊🤍 6. വിപരീതപദം😊 🤍 7. ൈശലികൾ പഴഞ്ചൊല്ലുകൾ 🤍 8. സമാനപദം 🤍 9. ചേർത്തെഴുതുക 🤍 10. സ്ത്രീലിംഗം പുല്ലിംഗം 🤍 11. വചനം 🤍 12. പിരിച്ചെഴുത്ത് 🤍 13. ഘടക പദം (വാക്യം ചേർത്തെഴുതുക) #ldcmalayalam #keralapscmalayalamclass #ldcmalayalamsyllabus #pirichezhuthu #malayalamkeralapscclass #malayala sahithyam for tenth level exam kerala psc #malayala sahithyam for twelfth level kerala psc exam #malayala sahityam for degree level kerala psc exam. #cpomalayalamsahithyam #degreelevelmalayalamsahithyam #twelfthlevelmalayalamsahithyam #tenthlevelmalayalmsahithyam #malayalamsahithyamkeralapsc #പ്രാചീനമലയാളസാഹിത്യം എഴുത്തച്ഛനു മുൻപുള്ള കാലത്തെ മലയാള സാഹിത്യത്തെയാണ് പ്രാചീന മലയാളസാഹിത്യം എന്ന് വീക്ഷിക്കുന്നത്. പ്രാചീനകാലത്തിൽ, കരിന്തമിഴിൽ സംസ്കൃതം കലർന്ന ഒരു മിശ്രഭാഷയായിട്ടായിരുന്നു മലയാളം നിലനിന്നിരുന്നത്.ഏ.ആർ രാജരാജവർമ പ്രാചീന മലയാളകാലത്തെ കരിന്തമിഴ്കാലമെന്നും മലയാണ്മക്കാലമെന്നും രണ്ടായി വിഭജിച്ചിരിക്കുന്നു. #കരിന്തമിഴ് കാലം പഴന്തമിഴിന്റെ അതിപ്രസരമുള്ള കാലഘട്ടമാണ് കരിന്തമിഴ് കാലം. '#രാമചരിതം' എന്ന കൃതിക്ക് മുൻപുള്ള കാലഘട്ടമാണിത് #മലയാണ്മക്കാലം പഴന്തമിഴിൽ നിന്ന് വേറിട്ട് മലയാളം സ്വതന്ത്രഭാഷയായി രൂപപ്പെട്ടുതുടങ്ങിയ കാലഘട്ടമാണിത്. ഇവിടം മുതലാണ് ഒരുവിധം വ്യക്തമായ മലയാളസാഹിത്യചരിത്രം ആരംഭിക്കുന്നത്. ' രാമചരിത'ത്തിന്റെ രചനാകാലമാണിത് മാധവപ്പണിക്കർ, ശങ്കരപ്പണിക്കർ, രാമപ്പണിക്കർ എന്നിവരാണ് നിരണം കവികൾ എന്നറിയപ്പെട്ടു പോരുന്നത് ക്ലാസിക്കൽ കാലഘട്ടം ചെറുശ്ശേരിനമ്പൂതിരിയുടെ കൃഷ്ണഗാഥ മലയാളസാഹിത്യത്തിന്റെ ക്ലാസിക്കൽ കാലഘട്ടത്തിന് തുടക്കം കുറിച്ചു എന്ന് പറയാം. കിളിപ്പാട്ട് പ്രസ്ഥാനത്തിന്റെ ഉപജ്ഞാതാവായ എഴുത്തച്ഛന്റെ പ്രധാന കൃതികൾ മഹാഭാരതം കിളിപ്പാട്ട്, അദ്ധ്യാത്മരാമായണം കിളിപ്പാട്ട്, ഇരുപത്തിനാലുവൃത്തം, #ഹരിനാമകീർത്തനം എന്നിവയാണ്. #പൂന്താനത്തിന്റെ #ജ്ഞാനപ്പാന'യും കീർത്തനങ്ങളും ഭക്തിപ്രസ്ഥാനത്തിന് ശക്തിപകർന്നു. ഉണ്ണായിവാര്യർ, കോട്ടയത്തു തമ്പുരാൻ, ഇരയിമ്മൻ തമ്പി തുടങ്ങിയവരുടെ ആട്ടക്കഥകളും മലയാളസാഹിത്യത്തെ പോഷിപ്പിച്ചു. തുള്ളൽ പ്രസ്ഥാനത്തിന്റെ വ്യവസ്ഥാപകനായ കുഞ്ചൻ നമ്പ്യാർ പതിനെട്ടാം നൂറ്റാണ്ടിലെ മലയാളഭാഷയെയും സാഹിത്യത്തെയും ഫലിതപ്രധാനമായ ആഖ്യാനശൈലിയാൽ സമ്പുഷ്ടമാക്കി. കുചേലവൃത്തം വഞ്ചിപ്പാട്ടെന്ന ഒറ്റ കൃതികൊണ്ടുതന്നെ രാമപുരത്തു വാര്യർ മലയാള സാഹിത്യചരിത്രത്തിൽ ചിരപ്രതിഷ്ഠ നേടി #ആധുനികകാലഘട്ടം പദ്യസാഹിത്യത്തോടൊപ്പംതന്നെ ഗദ്യസാഹിത്യവും ശക്തിപ്രാപിച്ച കാലഘട്ടമാണിത്. സാഹിത്യം, വ്യാകരണം എന്നിവയിൽ കേരളവർമ വലിയകോയിത്തമ്പുരാൻ, എ.ആർ. രാജരാജവർമ തുടങ്ങിയവരുടെ സംഭാവനകൾ വളരെ മഹത്തരമാണ്. #വേങ്ങയിൽകുഞ്ഞിരാമൻ നായനാരുടെ #വാസനാവികൃതിയാണ് മലയാളത്തിലെ #ആദ്യചെറുകഥ. ഒ. ചന്തുമേനോന്റെ 'ഇന്ദുലേഖ' എന്ന നോവലാണ് മലയാളത്തിലെ ആദ്യത്തെ ലക്ഷണമൊത്ത നോവൽ ആത്മകഥകൾ . ജോസഫ് മുണ്ടശ്ശേരിയുടെ ആത്മകഥയാണ് കൊഴിഞ്ഞ ഇലകൾ. എന്റെ കഥ' കമല സുറയ്യയുടേതാണ്. ' കണ്ണീരും കിനാവും'( വി ടി ഭട്ടതിരിപ്പാട്), 'ഓർമ്മയുടെ അറകൾ'(ബഷീർ), 'ആത്മകഥ' (ഇ എം എസ് ‌) എന്നിവ മലയാളത്തിലെ പ്രധാന ആത്മകഥകളാണ്. Malayalam syllabus wise classes for Kerala psc preliminary exam 12th and degree level. #1 padasudhi #2 vakyasudhi #3 paribhasha #4 ottapadam #5paryayam #6vipareedam #7shailikal and pazhamchollu #8 samanapadam #9 cherthezhuthu #10 streelimgam pullimgam #11vachanam #12pirichezhuthu #13khadakapadam (vakyam cherthezhuthu) #scertmalayalamclassstd3 #scertmalayalamclassstd4 #scertmalayalamclassstd5 #scertmalayalamclassstd6 #scertmalayalamclassstd7 #scertmalayalamclassstd8 #scertmalayalamclassstd9 #scertmalayalamclassstd10 #malayalamkavikal #keralapscmalayalamsahithyam #keralapscmalayalamwritters kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam #malayalamclassforkeralapscstudents #malayalamsahithyamforschoolstudents #malayalamsahithyamforktet #Ktetexammalayalam #Ktetexammalayalamsahithyam #Ktetexamclass #malayalam class for Ktet exam #sahithyacharithram #sahithyampreviousquestionkeralapsc #keralapscmalayalampreviousquestion #previous question kerala psc malayalam #malayalam kadhapathram krithikal #malayalam kavi vakyamgal #malayalam sahithyam for kerala psc exams #malayalam syllabus kerala psc #kerala psc malayalam full class #malayalam kerala psc fullsyllabus based class malayalam class for USS exam malayalam class for all psc exams

ഗുഡജിഹ്വികാന്യായം #മലയാളശൈലി #shorts Kerala psc Malayalam #funny educational video

3856673
101345
135
00:00:28
24.05.2022

ഗുഡജിഹ്വികാന്യായം #KAS202Previous question #മലയാളശൈലി #shorts Kerala psc Malayalam #funny educational video #26 #നീരക്ഷീരന്യായം #കേരളാ PSC ശൈലികൾ #shorts വേർതിരിച്ചറിയാൻകഴിയാത്ത തരത്തിലുള്ളകൂട്ടിച്ചേർക്കൽ ഏടുകെട്ടുക = പഠിത്തം അവസാനിപ്പിക്കുക പണ്ടൊക്കെ പത്താം ക്ലാസു പരീക്ഷയെ ഏടുകെട്ടു പരീക്ഷ എന്ന് വിളിച്ചിരുന്നു #shorts #Keralapscshorts #keralapsc #malayalamshailikal കേരളാ PSC ശൈലികൾ ശൈലികൾ#പഴഞ്ചൊല്ല് kerala psc മലയാളം Qn14😂ഇല്ലത്തെപൂച്ച #ശൈലികൾkerala pscmalayalam #shorts youtube psc shorts malayalam#ldc #degree level #ldc malayalam class #shailikal malayalam ഇ​ല്ല​ത്തെ​ ​പൂ​ച്ച എ​വി​ടെ​യും​ ​പ്ര​വേ​ശ​ന​മു​ള്ള​യാ​ൾ.​ ​ആ​രും​ ​ത​ട​യാ​ത്ത​തി​ന്റെ​ ​സൂ​ച​കം. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the topics ഓ​രോ​ഭാ​ഷ​യ്ക്കും​ത​ന​താ​യ​ശൈ​ലി​ക​ളും​ പ്ര​യോ​ഗ​ങ്ങ​ളു​മു​ണ്ട്.​ ഭാ​ഷ​യു​ടെ​ സ​മ്പ​ത്താ​ണ​വ.​ മ​ല​യാ​ള​ ഭാ​ഷ​യു​ടെ​ പ​ദ​ശേ​ഖ​ര​ത്തി​ൽ ​ മി​ന്നി​ത്തി​ള​ങ്ങു​ന്ന​ കു​റേ​ ​ ശൈ​ലി​ക​ൾ​ പ​രി​ച​യ​പ്പെടാം. പാ​ഠ​ഭാ​ഗ​ങ്ങ​ളു​മാ​യി​ ബ​ന്ധ​പ്പെ​ട്ട് ​ ഇ​വ​ ഹൃ​ദി​സ്ഥ​മാ​ക്കു​ക friendly psc യിൽ എടുത്തിട്ടുള്ള മുഴുവൻ ക്ലാസ്സുകളും ഉൾപ്പെടുത്തിക്കൊണ്ടുള്ള playlist ആണ് ഇത്. ചാനലിൽ എടുത്തിട്ടുള്ള എല്ലാ ക്ലാസുകളും കാണാൻ ആഗ്രഹമുള്ള കൂട്ടുകാർക്ക് ഇത് പ്രയോജനപ്പെടും. ഇനി പ്രത്യേക വിഷയങ്ങൾ മാത്രം കാണാൻ ആഗ്രഹിക്കുന്നവർക്കായി subject wise playlist ഉം നമ്മൾ ശരിയാക്കിയിട്ടുണ്ട്. eg-Kerala psc malayalam grammar ,vocabulary എന്ന playlist ൽ നമ്മൾ ചെയ്തിരിക്കുന്ന മുഴുവൻ മലയാളം ക്ലാസ്സുകളും ലഭിക്കും Kerala psc malayalam previous questions solved paper എന്ന playlist ൽ മലയാളത്തിലെ നമ്മൾ ചെയ്ത മുൻകാല ചോദ്യങ്ങൾ ലഭിക്കും Kerala psc ldc malayalam class എന്ന playlist ൽ LDC സിലബസ് പ്രകാരം നമ്മൾ ചെയ്ത എല്ലാ ക്ലാസുകളും ലഭിക്കും kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam malayalam bhedakam malayalam dyodakam malayalam vachanam malayalam vibhakthi malayalam kriya malayalam pattuvina malauyalam muttuvina malayalam samaasam kerala psc english vocabulary kerala psc english collective noun kerala psc english animal young one kerala psc animal sound kerala psc question tag english kerala psc english phrasal verb with code kerala psc prepositions kerala psc phrasal verbs kerala psc science class eye kerala psc science human body kerala psc science atom kerala psc periodic table class kerala psc Newtons law of motion kerala psc science properties of light kerala psc properties of matter kerala psc river kerala psc kerala related facts kerala psc india related facts kerala psc online class friendly psc kerala psc constitution class kerala psc indian river kerala psc kerala river kerala psc malayalam sahithyam kerala psc malayalam poets kerala psc online free class kerala psc online class for students free kerala psc class malayalam online class for kerala psc simple kerala psc class kerala psc classes for beginners kerala psc science class for beginners kerala psc science class for ldc exam kerala psc science class for uniform post kerala psc science class for secretariat assistant kerala psc class for preliminary exam kerala psc class for twelfth prelims kerala psc class for BDO exam kerala psc class for VEO kerala psc class for secretariat assistant This playlist contains many online psc classes.Kerala psc exam online classes of subjects like kerala psc malayalam grammar,kerala psc malayalam vocabulary,Kerala psc science classes,kerala psc english vocabulary,kerala psc english grammar ,kerala psc ldc classes,kerala psc tenth level preliminary exams,kerala psc tenth level syllabus wise classes,kerala psc plus two level syllabus wise classes, kerala psc degree level syllabus wise classes,kerala psc secretariat exam syllabus wise classes,kerala psc lpup assistant syllabus wise classes,kerala psc fireman and police exam syllabus wise classes ,All uniform post kerala psc exam syllabus wise classes are included in this play list. അ​ന​ന്ത​ൻ​കാ​ട് പൊ​തു​വേ​ ​ഭ​യ​മു​ണ്ടാ​ക്കു​ന്ന​ ​സ്ഥ​ല​ങ്ങ​ൾ,​ ​കേ​ന്ദ്ര​ങ്ങ​ൾ​ ​എ​ന്നി​വ​യു​ടെ​ ​പ്ര​തീ​കം. അ​ടി​മു​ടി​ ​ന​ശി​പ്പി​ക്കു​ക,​ ​വേ​രോ​ടെ​ ​ഇ​ല്ലാ​താ​ക്കു​ക,​ ​ഉ​ന്മൂ​ല​ ​നാ​ശം​ ​വ​രു​ത്തു​ക​ ​എ​ന്നൊ​ക്കെ​ ​സൂ​ചി​പ്പി​ക്കു​ന്നു. ആ​കാ​ശ​ ​കു​സു​മം ഒ​രി​ക്ക​ലും​ ​സം​ഭ​വി​ക്കാ​ത്ത​ ​കാ​ര്യ​മെ​ന്ന​തി​ന്റെ​ ​സൂ​ചന ആ​കാ​ശ​ ​പു​രാ​ണം ഇ​ല്ലാ​ത്ത​തി​ന്റെ​ ​സൂ​ച​ന.​ ​അ​സ​ത്യ​മാ​യ​ ​കാ​ര്യം ​ ആ​ല​ത്തൂ​ർ​ ​കാ​ക്ക ആ​ശി​ച്ചു​ ​കാ​ലം​ ​ക​ഴി​ക്കു​ന്ന​വൻ ഇ​ല​യി​ട്ടു​ ​ച​വി​ട്ടുക അ​റി​ഞ്ഞു​കൊ​ണ്ട് ​തെ​റ്റു​ ​ചെ​യ്യു​ന്ന​തി​ന്റെ​ ​സൂ​ചന

Collective noun revised part 1 Kerala psc english class എളുപ്പവഴിയിൽ പഠിക്കാം

103655
3983
262
00:08:22
28.04.2019

Collective noun part 1 Complete Course for Degree Level Uniform Posts (SI, EI, AJ) 🤍 group of stars cluster of, galaxy of , constellation of . Collective noun ,psc english class, collective noun memory trick.This class is very useful to remember the collective nouns . In this class i have used some tricky codes to remember the name of animals and their collective nouns. #collectivenounenglishclass #collectivenoun for mock test down load ilearn Kerala PSC app ദിവസേന PSC പരീക്ഷകൾ , ക്യാഷ് പ്രൈസ് , നോട്ട്സ് , മുൻകാല ചോദ്യപേപ്പറുകൾ , മോഡൽ പരീക്ഷകൾ ഇതൊക്കെ ലഭിക്കാൻ iLearn PSC ആപ്പ് ഇൻസ്റ്റാൾ ചെയ്യാം 🤍 #pscenglishclass #keralapsc #keralapscenglishgrammar #friendlypscenglishclass #colonyofants #colonyof #armyofants PSC English class #PSC #KERALA PSC #ENGLISH PSC MEMORY CODE #PSC CLASS ENGLISH #PSC UNIVERSITY ASSISTANT #VEO #LDC #ASSISTANT GRADE #FRIENDLY PSC # #KeralaPSC #Universityassistant #PSC #PSCquestions #PSCrepeatedQuestions #EasyPSC #PSCshortcuts #PSCcoachingClass #PSCexamPreparation #LDC #VEO #simplePSC #Codes #SimpleCodes Kerala PSC, University assistant, PSC questions, PSC repeated Questions, university assistant english class, PSC shortcuts, PSC coaching Class, PSC exam Preparation,video tutorial,psc coaching class malayalam,PSC malayalam class,ldc english class,tutorial in malayalam,veo,easy code,simple code, remember code,group of rats,swarm of, cluster of

Qn 19 #ഇലവു കാത്തകിളിശൈലി #LDC shailikalKerala PSC Preliminary Syllabus wise classes by Friendly PSC

681635
28847
260
00:00:27
15.06.2021

Qn 19 #ഇലവു കാത്തകിളിശൈലി #LDC shailikalKerala PSC Preliminary Syllabus wise classes by Friendly PSC ശൈലികൾ പഴംചൊല്ലു #Malayalam shaili kal Qn 17😉 #ധൃതരാഷ്ട്രാലിംഗനം ശൈലികൾ#പഴഞ്ചൊല്ല് kerala psc മലയാളം ഇല്ലത്തെപൂച്ച #ശൈലികൾkerala pscmalayalam #shorts youtube psc shorts malayalam#ldc #degree level #ldc malayalam class #shailikal malayalam ഇ​ല്ല​ത്തെ​ ​പൂ​ച്ച എ​വി​ടെ​യും​ ​പ്ര​വേ​ശ​ന​മു​ള്ള​യാ​ൾ.​ ​ആ​രും​ ​ത​ട​യാ​ത്ത​തി​ന്റെ​ ​സൂ​ച​കം. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the topics ഓ​രോ​ഭാ​ഷ​യ്ക്കും​ത​ന​താ​യ​ശൈ​ലി​ക​ളും​ പ്ര​യോ​ഗ​ങ്ങ​ളു​മു​ണ്ട്.​ ഭാ​ഷ​യു​ടെ​ സ​മ്പ​ത്താ​ണ​വ.​ മ​ല​യാ​ള​ ഭാ​ഷ​യു​ടെ​ പ​ദ​ശേ​ഖ​ര​ത്തി​ൽ ​ മി​ന്നി​ത്തി​ള​ങ്ങു​ന്ന​ കു​റേ​ ​ ശൈ​ലി​ക​ൾ​ പ​രി​ച​യ​പ്പെടാം. പാ​ഠ​ഭാ​ഗ​ങ്ങ​ളു​മാ​യി​ ബ​ന്ധ​പ്പെ​ട്ട് ​ ഇ​വ​ ഹൃ​ദി​സ്ഥ​മാ​ക്കു​ക friendly psc യിൽ എടുത്തിട്ടുള്ള മുഴുവൻ ക്ലാസ്സുകളും ഉൾപ്പെടുത്തിക്കൊണ്ടുള്ള playlist ആണ് ഇത്. ചാനലിൽ എടുത്തിട്ടുള്ള എല്ലാ ക്ലാസുകളും കാണാൻ ആഗ്രഹമുള്ള കൂട്ടുകാർക്ക് ഇത് പ്രയോജനപ്പെടും. ഇനി പ്രത്യേക വിഷയങ്ങൾ മാത്രം കാണാൻ ആഗ്രഹിക്കുന്നവർക്കായി subject wise playlist ഉം നമ്മൾ ശരിയാക്കിയിട്ടുണ്ട്. eg-Kerala psc malayalam grammar ,vocabulary എന്ന playlist ൽ നമ്മൾ ചെയ്തിരിക്കുന്ന മുഴുവൻ മലയാളം ക്ലാസ്സുകളും ലഭിക്കും Kerala psc malayalam previous questions solved paper എന്ന playlist ൽ മലയാളത്തിലെ നമ്മൾ ചെയ്ത മുൻകാല ചോദ്യങ്ങൾ ലഭിക്കും Kerala psc ldc malayalam class എന്ന playlist ൽ LDC സിലബസ് പ്രകാരം നമ്മൾ ചെയ്ത എല്ലാ ക്ലാസുകളും ലഭിക്കും kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam #Shorts Friendly PSC shorts Kerala PSC Malayala sahithyam #Thakazhi Sivasankara Pillai #Kerala maupassant #Kuttanaadinte Kadhaakaran #Chemmen #Ormayude Theerangal #Ente Vakkeel Jeevitham #Yenipadikal #Thottiyude Makan #Randidangazhi #Sahithya Visheshanam #Thoolika Naamangal #Friendly PSC Malayalam Class #LDC Malayalam Class മലയാളം SCERT FREE Crash Course ലെ Class No 9 #STD7SCERTmalayalamclass #keralapscsahithyam #SCERTmalayalamclass #sahithyamclasskeralapscmalayalam SCERTstd6th malayalam class SCERTmalayalamclassstd7 Standard7malayalamclass #scertmalayalamclass #scert malayalam class std9 #scert malayalam vocabulary kerla psc #Class9 #കോഡിലൂടെ​ മലയാളം മലയാളം FREE CRASH COURSE SCERT പാഠപുസ്തകത്തിലെ മലയാളം Kerala PSC Friendly PSC KERALA PSC MALAYALAM Kerala PSC Preliminary Syllabus wise classes by Friendly PSC.Malayalam class std 6, Malayalam class for SCERT students std6 #std6malayalamclass #keralapscmalayalamsahithyam #sahithyammalayalamforkeralapsc #scertmalayalamfactsforkeralapsc #scertmalayalamforkeralapscstudents Class No: 1 🤍 Class No: 2 🤍 Class No: 3 🤍 Class No: 4 🤍 Class No: 5 🤍 Class No: 6 🤍 Keralapsc malayalam ottapadam keralapsc malayalam ardham keralapsc malayalam vipareedam kerala psc malayalam paryayam Ldc malayalam class SI malayalam class SCERT malayalam class Keralapsc online malayalam class kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam malayalam bhedakam malayalam dyodakam malayalam vachanam malayalam vibhakthi malayalam kriya malayalam pattuvina malauyalam muttuvina malayalam samaasam #vaikkommuhammedbasheer #Madhavikutty #thoolikanamamprabha #keralapscldcclass The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

Thoolikanaamam തൂലികാനാമം #pen names malayalam class LDC 2020 Friendly psc kerala psc #trending

65338
2035
287
00:14:04
21.01.2020

Thoolikanaama #തൂലികാനാമം #pennames Kerala psc malayalam class LDC 2020 #malayalamthoolikanamam #Friendlypsc #keralapsccoaching #trending.തൂലികാനാമങ്ങൾ മലയാളം #pscthoolikanamam #pennames #kovilan #psycho #kalkki #തൂലികാനാമംസിനിക് #തൂലികാനാമംസൈക്കോ #തൂലികാനാമംനന്ദനാർ #തൂലികാനാമംആറ്റൂർ #തൂലികാനാമംകാക്കനാടൻ #തൂലികാനാമം മലങ്കാടൻ ദിവസേന PSC പരീക്ഷകൾ , ക്യാഷ് പ്രൈസ് , നോട്ട്സ് , മുൻകാല ചോദ്യപേപ്പറുകൾ , മോഡൽ പരീക്ഷകൾ ഇതൊക്കെ ലഭിക്കാൻ iLearn PSC ആപ്പ് ഇൻസ്റ്റാൾ ചെയ്യാo 🤍 ,#Varnam #aksharangal #mathra #Padam #vakyam #vaakku #malayalamgrammar #pscmalayalamgrammar #pscpreviousquestions #pscmalayalamclass 🤍 – Idioms Part 1, 🤍 – Idioms Part 2, 🤍 – Water Soluble vitamins, 🤍 – 1857 revolt leders, 🤍 – Fat soluble vitamins, 🤍 – Bird Sancturies in Kerala,🤍 – Cabinet Mission, 🤍 – Constituent Assembly, 🤍 – Vibhakthi Pratheyam Malayalam, 🤍 – Square Roots, 🤍 – Astronomy, 🤍 – Animals Young Ones, 🤍 – Prakaram, 🤍 – Resting Places of Leaders, 🤍 – National Parks in Kerala, 🤍 – Concord Part 1, 🤍 – Previous Year Science questions University assistant, 🤍 – Previous year constitution questions University assistant, 🤍 – Suare roots easy methods 101 -109, 🤍 – Concord Part 2, 🤍 – Compound Interest tricks, 🤍 – Explanation Compound Interest tricks 🤍 – sabdha vibhagam 🤍 - sabdha vibhagam 2 #KeralaPSC #Universityassistant #PSC #PSCquestions #PSCrepeatedQuestions #PSCshortcuts #PSCcoachingClass #PSCexamPreparation Kerala PSC, University assistant, PSC questions, PSC repeated Questions, Easy PSC, PSC shortcuts, PSC coaching Class, PSC exam Preparation The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#5#പര്യായംparyayam malayalam Ardham Kerala PSC Preliminary Syllabus wise classes by Friendly PSC

24599
1362
107
00:09:47
23.03.2021

paryayam malayalam Ardham Kerala PSC Preliminary Syllabus wise classes by Friendly PSC #പര്യായം= ഒന്നിനു പകരം ഉപയോഗിക്കുന്ന ഒരേ അര്‍ത്ഥമുള്ള മറ്റോരു പദം അക്തം = പുരട്ടാനുള്ളത്, എണ്ണ, കുഴമ്പ് അരിണി = പൂങ്കോഴി അവശീനം = തേൾ അയസ് = ഇരുമ്പ് അഹി = സർപ്പം അഹസ്സ് = പകൽ അഹസ്പതി = സൂര്യൻ അഹോവൃത്തി = അഹർവൃത്തി The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

2#വാക്യശുദ്ധി #Vakyasudhi #ldc #degreelevel kerala psc Kerala PSC Preliminary Friendly PSC

43360
2684
155
00:15:46
13.08.2021

2#വാക്യശുദ്ധി #Vakyasudhi #ldc #degreelevel police exam malayalam #uniformpost malayalam class 1. പദശുദ്ധി 🤍 2. വാക്യ ശുദ്ധി 🤍 3. പരിഭാഷ😊🤍 4. ഒറപദം 5. പര്യായം 6. വിപരീത പദം 7. ൈശലികൾ പഴഞ്ചൊല്ലുകൾ 8. സമാനപദം 9. ചേർത്തെഴുതുക 10. സ്ത്രീലിംഗം പുല്ലിംഗം 11. വചനം 12. പിരിച്ചെഴുത്ത് 13. ഘടക പദം (വാക്യം ചേർത്തെഴുതുക) kerala psc Kerala PSC Preliminary Friendly PSC #degreelevelmalayalam #ldcmalayalamclass #uniformpostmalayalamclass #vakyasudhescertmalayalam #vakyasudhiforschoolstudents #malayalamvocabularykeralapsc #keralapscmalayalampadasudhi #malayalampounarukthi #malayalamprakramabhamgam #malayalampadasudhi PADASUDHI #MALAYALAM CLASS#LDC #DEGREELEVEL #PSC Kerala PSC Friendly PSC Malayalam PSC pada sudhi previous question, മലയാളം പദശുദ്ധി PSC .Tricky psc class .Tricks to remember malayalam.PSC മലയാളം വ്യാകരണം This video containes previous psc questions from malayalam pada sudhi. #മലയാളംപദശുദ്ധി #മലയാളംവാക്യശുദ്ധി # #മലയാളംപദപ്രയോഗം #ഡിഗ്രിലെവൽ മലയാളം #മലയാളംതെറ്റുകൾ #മലയാളം പ്ലസ്ടുലെവൽകേരളPSC psc coaching class malayalam #malayalampadasushi #ldcmalayalamclass #universityassistantmalayalamclass #universityassistantmalayalamgrammar #veomalayalam #veopscclass #ldcmalayalamclass #universityassistantpscclass #keralapscmalayalam #malayalamgrammar #pscmalayalamgrammar #malayalampscclass #pscmalayalanclass #pscmalayalam #pscmalayalamgrammarnaamam,this video is a well explained and tricky class of malayalam for Kerala PSC students, #kerala psc|#malayalam grammar #മലയാളം വ്യാകരണം #pscmalayalamgrammarclass,#pscmalyalamvibakthiclass #keralapscmalayalamgrmmar #keralapscmalayalamclasa #kerala psc malayalam class #veryusefulmalayalamgrammarclass #psccoachingclassmalayalam The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

അയിരുകളും ധാതുക്കളും കോഡിലൂടെ പഠിക്കാം chemistry ore minerals Friendly psc k preliminary syllabus

200331
8415
770
00:23:53
29.09.2020

അയിരുകളും ധാതുക്കളും കോഡിലൂടെ പഠിക്കാം #ore #mineral #keralapscpreliminaryexam #chemistryclassforkeralapsc Ayirukalum dhadukkalum chemistry ore and minerals Friendly psc kerala psc preliminary syllabus #kerala PSC LDC class #friendlypsc #psc2020 #malayalam #keralapsc #preliminaryexam #keralapsccoaching #preliminarysyllabus #chemistryoreandminerals #ore #minerals #platinum #gold # #uranium #carnotite #pitchblande #alumminium #boxite #kreyolite #iron #hematite #magnetite #potassium #carnalite #silver #argentite #vandadium #petronite #tin #cassiterite [ #antimony #stibnite #copper #chalcopyrite #malakite #thorium #monozite #mercury #cinnabar #titanium #rutile #ilmenite #zinc #kalomeen #nickel #pendlanNdite #lead # galena Minerals and ores for kerala PSC exams class by Arya G. These notes will help you to understand the most common minerals and ores based questions which are repeatedly asked by kerala PSC : This video will be helpful to answer questions related to malayalam from the topic related to minerals and ores for all those who are appearing for PSC, ldc exams #keralapscmineral and ores #kerala PSC ldc mineral and ore #kerala PSC science The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#Class1കോഡിലൂടെ​SCERTമലയാളം FREE CRASH COURSE SCERT പാഠപുസ്തകത്തിലെമലയാളം Kerala PSC Friendly PSC

91799
5158
537
00:19:58
25.04.2021

മലയാളം SCERT Crash Course ലെ 1st Class #Class 1 #കോഡിലൂടെ​ മലയാളം മലയാളം FREE CRASH COURSE SCERT പാഠപുസ്തകത്തിലെ മലയാളം Kerala PSC Friendly PSC KERALA PSC MALAYALAM Kerala PSC Preliminary Syllabus wise classes by Friendly PSC Class No: 2 🤍 Class No: 3 🤍 Class No: 4 🤍 Class No: 5 🤍 Class No: 6 🤍 Class No: 7 🤍 kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam malayalam bhedakam malayalam dyodakam malayalam vachanam malayalam vibhakthi malayalam kriya malayalam pattuvina malauyalam muttuvina malayalam samaasam The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#വിവിധവൈദ്യുത പദ്ധതികൾകേരളം Electric Projects Hydro Electric Projects Friendly psc kerala psc

25938
1150
94
00:15:42
30.10.2020

വിവിധ വൈദ്യുത പദ്ധതികൾ #Electric Projects Hydro Electric Projects #Wind Farms #Solar Projects Friendly psc kerala psc coaching #Vydudapadhadikalkerala 🤍 Official telegram channel for Kerala PSC coaching by Arya G 🤍 FB page friendlypsc #vividhavydudapadhadikalpreliminaryexam #keralapscenergykerala #aryag #Keralapscpreliminaryclassonkerala KSEB Ltd has 31 hydro-electric projects, 7 solar projects, 2 diesel power plants & 1 wind farm.Power generation is also undertaken by Captive Mode Projects, Independent Power Mode Projects & Co-generation mode projects other than KSEBL .About 25% of the energy requirement is being met from hydel plants owned and operated by KSEBL .As of December 2019, The total installed capacity is 2823.01 MW ANERT in association with MNRE had conducted a detailed study of the wind potential of Kerala and this is estimated to be about 605 MW. Even though Kerala is blessed with such a high wind potential, the State could not harness it fully for its effective utillisation. ANERT had prepared a Detailed Project Report for establishing a Wind farm of 2 MW capacity, as a demonstration project, at Ramakkalmedu in Idukki district and submitted to MNRE for its approval. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.Pallivasal Extension #Adyanpara #Athirappally #Sengulam Augmentation #Sengulam Tailrace #Chathankottunada II #Poozhithode #Mangulam Maniyar tailrace (Ranni- Perinad) Perumthenaruvi Chimony Peechi Barapole Achankov

Qn 18 ശൂ..ശൂ രോഗങ്ങളുംരോഗകാരികളും Rogamgalum rogakarikalum keralapsc Kerala PSC #shorts #ldcbiology

426349
21627
282
00:01:00
13.06.2021

Qn18 😂 രോഗങ്ങളുംരോഗകാരികളും Rogamgalum rogakarikalum #ഡിഫ്തീരിയ #തൊണ്ടമുള്ളു #ഷിക്ടെസ്റ് വൈറസ് രോഗങ്ങൾ 🤍 ഫംഗസ് രോഗങ്ങൾ 🤍 ബാക്ടീരിയ രോഗങ്ങൾ 🤍 വായുവിലൂടെ പകരുന്ന രോഗങ്ങൾ 🤍 കൊതുക് പരത്തുന്ന രോഗങ്ങൾ 🤍 രോഗങ്ങളും രോഗകാരികളും full 🤍 രോഗവിശേഷണം 🤍 മനുഷ്യ ശരീരം പൊതു അറിവ് 🤍 🤍 #virus #bacteria #fungi #diseases The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

ആറ്റവും ഘടനയും Atom and Atomic structure #physicalscience PSC Preliminary Syllabus Friendly PSC

36791
1674
212
00:41:03
15.12.2020

ആറ്റവുംആറ്റത്തിൻ്റെ ഘടനയും Atom and Atomic structure #physicalscience #atom #atomicstructure #the smallest particle of a chemical element that can exist #atomose Latin word derived the word atom #500bc #ancient India # Greek philosophers #kanadha maharshi book #vaisheshika soothram #paramanu sidhantham #lucifus #democratus #1807 #atomic theory #johndalton #atom founder #solid sphere model #lawofmultipleproportion #austwalt #lawofconservation mass #lavocia #lawofconstant proportion #joseph sprout # #electron #founder #jjthomson #1904 #plumpudding #raisinpudding #watermelon #ernst Rutherford #1911 #alpha scattering gold and foil experiment #nucleus and proton founder #rutherford #father of nuclear physics #planetary model #solid model #nuclear model #bohr atom model #neil bohr #1913 #modification of Rutherford model of an atom #small positively charged nucleus is surrounded by revolving negatively charged electrons in fixed orbits # #shell #K, L, M, N #orbit # #1926 #erwin schrodinger #atom quantum mechanical #uncertainty principle #werner heisenberg #dual nature of electron, #louise de broglie #orbitals #subshells #s, p, d, f #nucleus #positive charge #proton #neutron #proton founder #rutherford #atomic number #num of protons #mission number #num of proton and neutron # James Chadwick #nutron founder # nucleon #proton or neutron when considered as a component of a nucleus # electron founder #jjthomson #oil drop experiment #robert milikan # measure elementary charge #proton mass #neutron mass #highestmass #electron #lowestmass #isotopes #one or two or more species of atoms of a chemical element with same atomic number and position in the periodic table and nearly identical chemical behavior but with different atomic masses and physical properties # isobar # element which differs in the chemical property but has the same physical property #different atomic number but same mass number #light atom #hydrogenatom #small atom #helium atom #big atom #cesium atom According to this model, the atom is a sphere of positive charge, and negatively charged electrons are embedded in it to balance the total positive charge. In the Bohr model of the atom, electrons travel in defined circular orbits around the nucleus. The orbits are labeled by an integer, the quantum number n. Electrons can jump from one orbit to another by emitting or absorbing energy. Erwin Schrodinger. A powerful model of the atom was developed by Erwin Schrödinger in 1926. Schrödinger's model allowed the electron to occupy three-dimensional space. Isotopes are variants of a particular chemical element which differ in neutron number, and consequently in nucleon number. All isotopes of a given element have the same number of protons but different numbers of neutrons in each atom. Isobars are atoms (nuclides) of different chemical elements that have the same number of nucleons. Correspondingly, isobars differ in atomic number (or number of protons) but have the same mass number. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#4 ഒറ്റപദം #LDC #Degree level Uniform post ottapadammalayalam #oneword malayalam Kerala psc class

26180
1589
107
00:11:19
18.08.2021

#4 ഒറ്റപദം #LDC #Degree level Uniform post ottapadammalayalam #oneword malayalam Kerala psc class 1. പദശുദ്ധി 🤍 2. വാക്യ ശുദ്ധി 🤍 3. പരിഭാഷ😊 🤍 4. ഒറ്റപദം 5. പര്യായം 6. വിപരീത പദം 7. ൈശലികൾ പഴഞ്ചൊല്ലുകൾ 8. സമാനപദം 9. ചേർത്തെഴുതുക 10. സ്ത്രീലിംഗം പുല്ലിംഗം 11. വചനം 12. പിരിച്ചെഴുത്ത് 13. ഘടക പദം (വാക്യം ചേർത്തെഴുതുക) #ottapadamkerala psc #ottapadam malayalam kerala psc #ottapadam ldc malayalam #kerala psc malayalam vocanulary #malayalam class for kerala psc #kerala psc degree level exam malayalam #ldc malayalam vocabulary #malayalam ldc class ottapadam #ottapadam from scert classes #malayalam ottapadam for school students #ottappadam malayalam vocabulary #ldc ottapadam #degree level ottappadam malayalam #ottapadammalayalam #oneword preliminary exam malayalam Kerala PSC Preliminary classes Friendly PSC #ottapadamkeralapscmalayalam #ottapadampreliminaryexam #ottapadamscertmalayalam #ottapadamcbscmalayalam 1. #തരണംചെയ്യാന്‍ ഇച്ഛിക്കുന്നവന്‍-തിതീര്‍ഷു 2. #നയിക്കാന്‍ ഇച്ഛിക്കുന്നവന്‍-നിനീഷു 3. #അഭിമുഖം-മുഖത്തിനു നേരെ 4. #അധുനാതനം-ഇപ്പോൾ ഉള്ളത് 5. #അനിയന്ത്രിതം-നിയന്ത്രിക്കാൻ കഴിയാത്തത് 6. #അവിഭാജ്യം - വിഭജിക്കാൻ കഴിയാത്ത് 7. #ആർഷം - ഋഷിയെ സംബന്ധിച്ചത് 8. #ആത്മീയം - ആത്മാവിനെ സംബന്ധിച്ചത് 9. #ആപാദചൂഡം - പാദം മുതൽ ശിരസ്സുവരെ 10. #ആബാലവൃദ്ധം - ബാലൻ മുതൽ വൃദ്ധൻ വരെ 11. #ആമൂലാഗ്രം - വേരുമുതൽ തലപ്പുവരെ 12. #ആനുകാലികം - കാലം അനുസരിച്ചുള്ളത് 13. #ഉത്കർഷേച്ഛു - ഉയർച്ച ആഗ്രഹിക്കുന്ന ആൾ 14. #ഉത്പതിഷ്ണു - മാറ്റം ആഗ്രഹിക്കുന്ന ആൾ 15. #ഐഹികം - ഇഹലോകത്തെ സംബന്ധിച്ചത് 16. #കാർഷികം - കൃഷിയെ സംബന്ധിച്ചത് 17. #ക്രാന്തദർശി - കടന്നുകാണാൻ കഴിവുള്ളവൻ 18. #ഗാർഹികം - ഗൃഹത്തെ സംബന്ധിച്ചത് 19. #ഗർണണീയം - ഉപേക്ഷിക്കത്തക്കത് 20. #ജിജ്ഞാസു - അറിയുവാൻ ആഗ്രഹിക്കുന്ന ആൾ 21. #ദിദൃക്ഷു - കാണാൻ ആഗ്രഹിക്കുന്ന ആൾ The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

Qn 16😉 കായംകുളം വാൾ ശൈലി Kerala PSC #LDC #degreelevel malayalam #shorts #youtubepsc Friendly PSC

250105
12369
230
00:00:58
07.06.2021

Qn 16 കായംകുളം വാൾ ശൈലി Kerala PSC #LDC #degreelevel malayalam #shorts #youtubepsc Friendly PSC ഇല്ലത്തെപൂച്ച #ശൈലികൾkerala pscmalayalam #shorts youtube psc shorts malayalam#ldc #degree level #ldc malayalam class #shailikal malayalam ഇ​ല്ല​ത്തെ​ ​പൂ​ച്ച എ​വി​ടെ​യും​ ​പ്ര​വേ​ശ​ന​മു​ള്ള​യാ​ൾ.​ ​ആ​രും​ ​ത​ട​യാ​ത്ത​തി​ന്റെ​ ​സൂ​ച​കം. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the topics ഓ​രോ​ഭാ​ഷ​യ്ക്കും​ത​ന​താ​യ​ശൈ​ലി​ക​ളും​ പ്ര​യോ​ഗ​ങ്ങ​ളു​മു​ണ്ട്.​ ഭാ​ഷ​യു​ടെ​ സ​മ്പ​ത്താ​ണ​വ.​ മ​ല​യാ​ള​ ഭാ​ഷ​യു​ടെ​ പ​ദ​ശേ​ഖ​ര​ത്തി​ൽ ​ മി​ന്നി​ത്തി​ള​ങ്ങു​ന്ന​ കു​റേ​ ​ ശൈ​ലി​ക​ൾ​ പ​രി​ച​യ​പ്പെടാം. പാ​ഠ​ഭാ​ഗ​ങ്ങ​ളു​മാ​യി​ ബ​ന്ധ​പ്പെ​ട്ട് ​ ഇ​വ​ ഹൃ​ദി​സ്ഥ​മാ​ക്കു​ക friendly psc യിൽ എടുത്തിട്ടുള്ള മുഴുവൻ ക്ലാസ്സുകളും ഉൾപ്പെടുത്തിക്കൊണ്ടുള്ള playlist ആണ് ഇത്. ചാനലിൽ എടുത്തിട്ടുള്ള എല്ലാ ക്ലാസുകളും കാണാൻ ആഗ്രഹമുള്ള കൂട്ടുകാർക്ക് ഇത് പ്രയോജനപ്പെടും. ഇനി പ്രത്യേക വിഷയങ്ങൾ മാത്രം കാണാൻ ആഗ്രഹിക്കുന്നവർക്കായി subject wise playlist ഉം നമ്മൾ ശരിയാക്കിയിട്ടുണ്ട്. eg-Kerala psc malayalam grammar ,vocabulary എന്ന playlist ൽ നമ്മൾ ചെയ്തിരിക്കുന്ന മുഴുവൻ മലയാളം ക്ലാസ്സുകളും ലഭിക്കും Kerala psc malayalam previous questions solved paper എന്ന playlist ൽ മലയാളത്തിലെ നമ്മൾ ചെയ്ത മുൻകാല ചോദ്യങ്ങൾ ലഭിക്കും Kerala psc ldc malayalam class എന്ന playlist ൽ LDC സിലബസ് പ്രകാരം നമ്മൾ ചെയ്ത എല്ലാ ക്ലാസുകളും ലഭിക്കും kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam malayalam bhedakam malayalam dyodakam malayalam vachanam malayalam vibhakthi malayalam kriya malayalam pattuvina malauyalam muttuvina malayalam samaasam kerala psc english vocabulary kerala psc english collective noun kerala psc english animal young one kerala psc animal sound kerala psc question tag english kerala psc english phrasal verb with code kerala psc prepositions kerala psc phrasal verbs kerala psc science class eye kerala psc science human body kerala psc science atom kerala psc periodic table class kerala psc Newtons law of motion kerala psc science properties of light kerala psc properties of matter kerala psc river kerala psc kerala related facts kerala psc india related facts kerala psc online class friendly psc kerala psc constitution class kerala psc indian river kerala psc kerala river kerala psc malayalam sahithyam kerala psc malayalam poets kerala psc online free class kerala psc online class for students free kerala psc class malayalam online class for kerala psc simple kerala psc class kerala psc classes for beginners kerala psc science class for beginners kerala psc science class for ldc exam kerala psc science class for uniform post kerala psc science class for secretariat assistant kerala psc class for preliminary exam kerala psc class for twelfth prelims kerala psc class for BDO exam kerala psc class for VEO kerala psc class for secretariat assistant This playlist contains many online psc classes.Kerala psc exam online classes of subjects like kerala psc malayalam grammar,kerala psc malayalam vocabulary,Kerala psc science classes,kerala psc english vocabulary,kerala psc english grammar ,kerala psc ldc classes,kerala psc tenth level preliminary exams,kerala psc tenth level syllabus wise classes,kerala psc plus two level syllabus wise classes, kerala psc degree level syllabus wise classes,kerala psc secretariat exam syllabus wise classes,kerala psc lpup assistant syllabus wise classes,kerala psc fireman and police exam syllabus wise classes ,All uniform post kerala psc exam syllabus wise classes are included in this play list. അ​ന​ന്ത​ൻ​കാ​ട് പൊ​തു​വേ​ ​ഭ​യ​മു​ണ്ടാ​ക്കു​ന്ന​ ​സ്ഥ​ല​ങ്ങ​ൾ,​ ​കേ​ന്ദ്ര​ങ്ങ​ൾ​ ​എ​ന്നി​വ​യു​ടെ​ ​പ്ര​തീ​കം. അ​ടി​മു​ടി​ ​ന​ശി​പ്പി​ക്കു​ക,​ ​വേ​രോ​ടെ​ ​ഇ​ല്ലാ​താ​ക്കു​ക,​ ​ഉ​ന്മൂ​ല​ ​നാ​ശം​ ​വ​രു​ത്തു​ക​ ​എ​ന്നൊ​ക്കെ​ ​സൂ​ചി​പ്പി​ക്കു​ന്നു. ആ​കാ​ശ​ ​കു​സു​മം ഒ​രി​ക്ക​ലും​ ​സം​ഭ​വി​ക്കാ​ത്ത​ ​കാ​ര്യ​മെ​ന്ന​തി​ന്റെ​ ​സൂ​ചന ആ​കാ​ശ​ ​പു​രാ​ണം ഇ​ല്ലാ​ത്ത​തി​ന്റെ​ ​സൂ​ച​ന.​ ​അ​സ​ത്യ​മാ​യ​ ​കാ​ര്യം ​ ആ​ല​ത്തൂ​ർ​ ​കാ​ക്ക ആ​ശി​ച്ചു​ ​കാ​ലം​ ​ക​ഴി​ക്കു​ന്ന​വൻ ഇ​ല​യി​ട്ടു​ ​ച​വി​ട്ടുക അ​റി​ഞ്ഞു​കൊ​ണ്ട് ​തെ​റ്റു​ ​ചെ​യ്യു​ന്ന​തി​ന്റെ​ ​സൂ​ചന രാ​മേ​ശ്വ​ര​ത്തെ​ ​ക്ഷൗ​രം ഒ​രു​ ​കാ​ര്യം​പൂ​ർ​ത്തി​യാ​ക്കാ​ത്ത​ ​അ​വ​സ്ഥThe main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

Hydrogen and Oxygen kerala psc preliminary physical science class Kerala PSCPreliminary friendly psc

10756
344
47
00:02:34
23.12.2020

Hydrogen and Oxygen kerala psc preliminary physical science class ഹൈഡ്രജൻ ക്ലാസ് 🤍 ഓക്സിജൻ ക്ലാസ് 🤍 🤍 Kerala PSC Preliminary Syllabus wise classes by Friendly PSC Oxygen kerala psc preliminary exam syllabus science class Friendly psc kerala psc coaching #oxygen Official telegram channel for Kerala PSC coaching by Arya G 🤍 #oxygen#unaccademy#friendly psc#aryag#friendlypsc10#scert#joseph priestly#hydrogen#lavosia#father of chemistry#oxygenes# അംശിക സ്വേതനം # ജ്വലനം # പൊട്ടാസ്യം പെർമാഗനേറ്റ് # ജീവവായു # കത്താൻ സഹായിക്കുന്ന വാതകം # ജൈവ വിഘടനം #O2# ഓക്സീകാരി # Rocket fuel# കൃത്രിമ ശ്വാസം # H2O #Atmosphere #earth Crust # Human body# O2 Atomic number #periodic table #16th group #oxygen family #chalcogen family #oxide #Chalcogens# ozon #christian shornben#stratosphere #charles fabri#Henty Viewson #CFC#clorin#O3#O2-O3 cycling #UVRays#September 16#Ozone day The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points. physical science class kerala psc #physical science class #kerala psc class The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points. Hydrogen kerala psc #priliminary syllabus science Friendly psc kerala psc coaching #Hydrogen isotope #scert based PSC class 🤍 Official telegram channel for Kerala PSC coaching by Arya G 🤍 The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points. : #psckerala #preliminarysyllabus #friendlypsc #keralapsc #hydrogen #inflammableair #hydrogenisotope #lousia : #hydrogene #hendicavandish # founder # inflammableair # acid # metal # hydrogen# zinc #hydrochloricacid # calorific value #heat value of a fuel is the amount of heat released during its combustion #boschprocess # di hydrogen # coal and water # steam passed over catalyst # fe203 #chemicalreaction #catalytic steam # hydrocarbon process # vaporized hydrocarbon #hydrogen atomic no 1 # lowdensity # colourless # odorlessgas # tasteless gas #properties #present in certain foods #sugar #fats #polythene # protein # nitrogen # acid # hydrogen # isotope # variants of particular chemical element # differ in neutron number # nucleon number # have same number of protons but different number of neutrons #types of isotopes # protium # deuterium # tritium # protium # no neutron # deuterium has one neutron # tritium has two neutron # Hydrogen bomb # deuterium # tritium #h20 #water #d20 # heavy water #t20 # super heavy water #hydrogensulphide #hydrogen #bleachingagent #hydrogenperoxide # vanaspati #liquidhydrogen # rocketfuel : This video covers some major points regarding the element hydrogen . All important questions included for psc exam Hydrogen Isotopes Protium Deutrium Tritium

കോഡിലൂടെ കേരള കാർഷിക ഗവേഷണകേന്ദ്രങ്ങൾ Kerala karshika gaveshana kendramgal Friendly psc

29168
1475
176
00:18:17
12.11.2020

കോഡിലൂടെ കേരള കാർഷിക ഗവേഷണകേന്ദ്രങ്ങൾ Kerala karshika gaveshana kendramgal Friendly psc 🤍 Official telegram channel for Kerala PSC coaching by Arya G 🤍 കേരളത്തിലെ പ്രധാന ഭക്ഷ്യ കാർഷിക വിളകൾ #panniyoor #oodakkali #കുരുമുളക് ഗവേഷണ കേന്ദ്രം #ഏത്തവാഴഗവേഷണകേന്ദ്രം #കാപ്പി ഗവേഷണകേന്ദ്രം #ഇഞ്ചിഗവേഷണകേന്ദ്രം The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

PSC ചോദിച്ച#പിരിച്ചെഴുത്ത് #ചേർത്തെഴുത്ത് Pirichezhuthu Cherthezhuthu#FriendlyPSC #sandhi #keralapsc

12677
690
41
00:06:33
03.12.2021

#പിരിച്ചെഴുത്ത് #ചേർത്തെഴുത്ത് Pirichezhuthu Cherthezhuthu #Friendly PSC #kerala[sc #sandhi #psc The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

Collective noun part 2 kerala psc english class എളുപ്പവഴിയിൽ പഠിക്കാം

52993
2532
229
00:11:21
28.04.2019

Collective noun memory trick #keralapscenglishclass #collectivenounmemorytechnique group of stars cluster of, galaxy of , constellation of . Collective noun ,psc english class, collective noun memory trick.This class is very useful to remember the collective nouns . In this class i have used some tricky codes to remember the name of animals and their collective nouns. #collectivenounenglishclass #collectivenoun for mock test down load ilearn Kerala PSC app ദിവസേന PSC പരീക്ഷകൾ , ക്യാഷ് പ്രൈസ് , നോട്ട്സ് , മുൻകാല ചോദ്യപേപ്പറുകൾ , മോഡൽ പരീക്ഷകൾ ഇതൊക്കെ ലഭിക്കാൻ iLearn PSC ആപ്പ് ഇൻസ്റ്റാൾ ചെയ്യാം 🤍 #pscenglishclass #keralapsc #keralapscenglishgrammar #friendlypscenglishclass #colonyofants #colonyof #armyofants PSC English class #PSC #KERALA PSC #ENGLISH PSC MEMORY CODE #PSC CLASS ENGLISH #PSC UNIVERSITY ASSISTANT #VEO #LDC #ASSISTANT GRADE #FRIENDLY PSC # #KeralaPSC #Universityassistant #PSC #PSCquestions #PSCrepeatedQuestions #EasyPSC #PSCshortcuts #PSCcoachingClass #PSCexamPreparation #LDC #VEO #simplePSC #Codes #SimpleCodes Kerala PSC, University assistant, PSC questions, PSC repeated Questions, Easy PSC, PSC shortcuts, PSC coaching Class, PSC exam Preparation,video tutorial,psc coaching class malayalam,PSC malayalam class,ldc,tutorial in malayalam,veo,easy code,simple code, remember code,codes

Qn 17#ധൃതരാഷ്ട്രാലിംഗനം #shorts Shailikal Kerala PSC #LDC #LDC malayalam shailikal #Degree level psc

26038
2875
234
00:00:41
11.06.2021

Qn 17 ശൈലികൾ പഴംചൊല്ലു #Malayalam shaili kal Qn 17😉 #ധൃതരാഷ്ട്രാലിംഗനം ശൈലികൾ#പഴഞ്ചൊല്ല് kerala psc മലയാളം ഇല്ലത്തെപൂച്ച #ശൈലികൾkerala pscmalayalam #shorts youtube psc shorts malayalam#ldc #degree level #ldc malayalam class #shailikal malayalam ഇ​ല്ല​ത്തെ​ ​പൂ​ച്ച എ​വി​ടെ​യും​ ​പ്ര​വേ​ശ​ന​മു​ള്ള​യാ​ൾ.​ ​ആ​രും​ ​ത​ട​യാ​ത്ത​തി​ന്റെ​ ​സൂ​ച​കം. The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the topics ഓ​രോ​ഭാ​ഷ​യ്ക്കും​ത​ന​താ​യ​ശൈ​ലി​ക​ളും​ പ്ര​യോ​ഗ​ങ്ങ​ളു​മു​ണ്ട്.​ ഭാ​ഷ​യു​ടെ​ സ​മ്പ​ത്താ​ണ​വ.​ മ​ല​യാ​ള​ ഭാ​ഷ​യു​ടെ​ പ​ദ​ശേ​ഖ​ര​ത്തി​ൽ ​ മി​ന്നി​ത്തി​ള​ങ്ങു​ന്ന​ കു​റേ​ ​ ശൈ​ലി​ക​ൾ​ പ​രി​ച​യ​പ്പെടാം. പാ​ഠ​ഭാ​ഗ​ങ്ങ​ളു​മാ​യി​ ബ​ന്ധ​പ്പെ​ട്ട് ​ ഇ​വ​ ഹൃ​ദി​സ്ഥ​മാ​ക്കു​ക friendly psc യിൽ എടുത്തിട്ടുള്ള മുഴുവൻ ക്ലാസ്സുകളും ഉൾപ്പെടുത്തിക്കൊണ്ടുള്ള playlist ആണ് ഇത്. ചാനലിൽ എടുത്തിട്ടുള്ള എല്ലാ ക്ലാസുകളും കാണാൻ ആഗ്രഹമുള്ള കൂട്ടുകാർക്ക് ഇത് പ്രയോജനപ്പെടും. ഇനി പ്രത്യേക വിഷയങ്ങൾ മാത്രം കാണാൻ ആഗ്രഹിക്കുന്നവർക്കായി subject wise playlist ഉം നമ്മൾ ശരിയാക്കിയിട്ടുണ്ട്. eg-Kerala psc malayalam grammar ,vocabulary എന്ന playlist ൽ നമ്മൾ ചെയ്തിരിക്കുന്ന മുഴുവൻ മലയാളം ക്ലാസ്സുകളും ലഭിക്കും Kerala psc malayalam previous questions solved paper എന്ന playlist ൽ മലയാളത്തിലെ നമ്മൾ ചെയ്ത മുൻകാല ചോദ്യങ്ങൾ ലഭിക്കും Kerala psc ldc malayalam class എന്ന playlist ൽ LDC സിലബസ് പ്രകാരം നമ്മൾ ചെയ്ത എല്ലാ ക്ലാസുകളും ലഭിക്കും kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam #Shorts Friendly PSC shorts Kerala PSC Malayala sahithyam #Thakazhi Sivasankara Pillai #Kerala maupassant #Kuttanaadinte Kadhaakaran #Chemmen #Ormayude Theerangal #Ente Vakkeel Jeevitham #Yenipadikal #Thottiyude Makan #Randidangazhi #Sahithya Visheshanam #Thoolika Naamangal #Friendly PSC Malayalam Class #LDC Malayalam Class മലയാളം SCERT FREE Crash Course ലെ Class No 9 #STD7SCERTmalayalamclass #keralapscsahithyam #SCERTmalayalamclass #sahithyamclasskeralapscmalayalam SCERTstd6th malayalam class SCERTmalayalamclassstd7 Standard7malayalamclass #scertmalayalamclass #scert malayalam class std9 #scert malayalam vocabulary kerla psc #Class9 #കോഡിലൂടെ​ മലയാളം മലയാളം FREE CRASH COURSE SCERT പാഠപുസ്തകത്തിലെ മലയാളം Kerala PSC Friendly PSC KERALA PSC MALAYALAM Kerala PSC Preliminary Syllabus wise classes by Friendly PSC.Malayalam class std 6, Malayalam class for SCERT students std6 #std6malayalamclass #keralapscmalayalamsahithyam #sahithyammalayalamforkeralapsc #scertmalayalamfactsforkeralapsc #scertmalayalamforkeralapscstudents Class No: 1 🤍 Class No: 2 🤍 Class No: 3 🤍 Class No: 4 🤍 Class No: 5 🤍 Class No: 6 🤍 Keralapsc malayalam ottapadam keralapsc malayalam ardham keralapsc malayalam vipareedam kerala psc malayalam paryayam Ldc malayalam class SI malayalam class SCERT malayalam class Keralapsc online malayalam class kerala psc malayalam grammar class kerala psc malayalam vocabulary class kerala psc online malayalam class kerala psc malayalam class SCERT syllabus malayalam class for CBSC students malayalam class for SCERT students malayalam class for college students malayalam class for school students malayalam class for LSS exam malayalam class for USS exam malayalam class for all psc exams malayalam sandhi class malayalam samasam class malayalam cherthezhuthu malayalam pirichezhuthu malayalam thoolikanamamgal with code malayalam kavi vachanam malayalam bhedakam malayalam dyodakam malayalam vachanam malayalam vibhakthi malayalam kriya malayalam pattuvina malauyalam muttuvina malayalam samaasam #vaikkommuhammedbasheer #Madhavikutty #thoolikanamamprabha #keralapscldcclass The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

#5പര്യായം paryayam #ldc paryayam degree level malayalam kerala psc #uniform post malayalam

27814
1384
91
00:17:15
20.08.2021

#5പര്യായം paryayam #ldc paryayam degree level malayalam kerala psc #uniform post malayalam 1. പദശുദ്ധി 🤍 2. വാക്യ ശുദ്ധി 🤍 3. പരിഭാഷ😊 🤍 4. ഒറ്റപദം 5. പര്യായം 6. വിപരീത പദം 7. ൈശലികൾ പഴഞ്ചൊല്ലുകൾ 8. സമാനപദം 9. ചേർത്തെഴുതുക 10. സ്ത്രീലിംഗം പുല്ലിംഗം 11. വചനം 12. പിരിച്ചെഴുത്ത് 13. ഘടക പദം (വാക്യം ചേർത്തെഴുതുക) ഒരു വസ്തു ഒന്നിനെ വിട്ട് മറ്റൊന്നിനെ എന്ന മുറയ്ക്ക് പല വസ്തുക്കളെ പ്രാപിക്കുന്നതായോ അല്ലെങ്കിൽ പല വസ്തുക്കൾ ഓരോന്നായി ഒന്നിനെ പ്രാപിക്കുന്നതായോ പറയുന്നത് പര്യായം. 'പര്യായമൊന്നു പലതിൻ മുറയ്ക്കു പലതൊന്നിലും' #paryayam malayalam #keralapscmalayalam #kerala psc malayalam ldc #paryayam degree level malayalam #ldc malayalam vocabulary #malayalam vocabulary kerala psc #kerala psc malayalam paryayam #malayalam paryayam for kerala psc uniform post #uniform post malayalam vocabulary #malayalam vocabulary from scert #malayalam vocabulary for school students #malayalam vocabulary for kerala psc #malayalam samana padam #paryayam class #paryayam and samana padam The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

ശബ്ദ വിഭാഗം - Kerala PSC - മലയാളം

31147
1277
73
00:05:22
26.03.2019

shabda vibhadam,#Varnam #aksharangal #mathra #Padam #vakyam #vaakku #malayalamgrammar #pscmalayalamgrammar #pscpreviousquestions 🤍 – Idioms Part 1, 🤍 – Idioms Part 2, 🤍 – Water Soluble vitamins, 🤍 – 1857 revolt leders, 🤍 – Fat soluble vitamins, 🤍 – Bird Sancturies in Kerala,🤍 – Cabinet Mission, 🤍 – Constituent Assembly, 🤍 – Vibhakthi Pratheyam Malayalam, 🤍 – Square Roots, 🤍 – Astronomy, 🤍 – Animals Young Ones, 🤍 – Prakaram, 🤍 – Resting Places of Leaders, 🤍 – National Parks in Kerala, 🤍 – Concord Part 1, 🤍 – Previous Year Science questions University assistant, 🤍 – Previous year constitution questions University assistant, 🤍 – Suare roots easy methods 101 -109, 🤍 – Concord Part 2, 🤍 – Compound Interest tricks, 🤍 – Explanation Compound Interest tricks Key words general #KeralaPSC #Universityassistant #PSC #PSCquestions #PSCrepeatedQuestions #EasyPSC #PSCshortcuts #PSCcoachingClass #PSCexamPreparation Kerala PSC, University assistant, PSC questions, PSC repeated Questions, Easy PSC, PSC shortcuts, PSC coaching Class, PSC exam Preparation

Jobina Rank 14 LDC Idukki #LDC #PSC #malayalamclass #friendlypsc

9326
378
41
00:00:30
06.08.2022

Jobina Abraham Rank 14 LDC Idukki LDC 2022 #pscmalayalam #PSCMALAYALAMCLASS #friendlypscarya #shorts #pscshorts #ldcresult #pscmalayalamclass

തദ്ധിതം മലയാളം Malayalam grammar kerala psc

54864
2340
205
00:13:09
18.12.2019

തദ്ധിതം #malayalamgrammar #keralapsc #naamam #keralapscmalayalamclass This malayalam class is a well explained class of Tadhidam.I have well explained various types of Tadhidam.A psc aspirant can easily catch my classes,and can score full mark in Kerala psc malayalam. psc coaching class malayalam #ldcmalayalamclass #VEOmalayalamclass #LDCmalayalamclass #vinayacham #peracham #naamamgajam #kriyamgajam #universityassistantmalayalamclass #universityassistantmalayalamgrammar #veomalayalam #veopscclass #ldcmalayalamclass #universityassistantpscclass #dravyanaamam #ദ്രവ്യനാമം #സാമാന്യ നാമം #മേയനാമം #സർവ്വനാമം #gunanaamam #ഗുണനാമം #kriyanaamam #ക്രിയാനാമം #meyanaamam #സജ്ഞാനാമം #keralapscmalayalam #malayalamgrammar #pscmalayalamgrammar #malayalampscclass #pscmalayalanclass #pscmalayalam #pscmalayalamgrammarnaamam, #kerala psc|#malayalam grammar #മലയാളം വ്യാകരണം #pscmalayalamgrammarclass,#pscmalyalamvibakthiclass

#4 #ഒറ്റപദം #ottapadammalayalam #oneword preliminary exam malayalam Preliminary classe Friendly PSC

33582
1943
170
00:12:53
21.03.2021

#ottapadammalayalam #oneword preliminary exam malayalam Kerala PSC Preliminary classes Friendly PSC #ottapadamkeralapscmalayalam #ottapadampreliminaryexam #ottapadamscertmalayalam #ottapadamcbscmalayalam 1. #തരണംചെയ്യാന്‍ ഇച്ഛിക്കുന്നവന്‍-തിതീര്‍ഷു 2. #നയിക്കാന്‍ ഇച്ഛിക്കുന്നവന്‍-നിനീഷു 3. #അഭിമുഖം-മുഖത്തിനു നേരെ 4. #അധുനാതനം-ഇപ്പോൾ ഉള്ളത് 5. #അനിയന്ത്രിതം-നിയന്ത്രിക്കാൻ കഴിയാത്തത് 6. #അവിഭാജ്യം - വിഭജിക്കാൻ കഴിയാത്ത് 7. #ആർഷം - ഋഷിയെ സംബന്ധിച്ചത് 8. #ആത്മീയം - ആത്മാവിനെ സംബന്ധിച്ചത് 9. #ആപാദചൂഡം - പാദം മുതൽ ശിരസ്സുവരെ 10. #ആബാലവൃദ്ധം - ബാലൻ മുതൽ വൃദ്ധൻ വരെ 11. #ആമൂലാഗ്രം - വേരുമുതൽ തലപ്പുവരെ 12. #ആനുകാലികം - കാലം അനുസരിച്ചുള്ളത് 13. #ഉത്കർഷേച്ഛു - ഉയർച്ച ആഗ്രഹിക്കുന്ന ആൾ 14. #ഉത്പതിഷ്ണു - മാറ്റം ആഗ്രഹിക്കുന്ന ആൾ 15. #ഐഹികം - ഇഹലോകത്തെ സംബന്ധിച്ചത് 16. #കാർഷികം - കൃഷിയെ സംബന്ധിച്ചത് 17. #ക്രാന്തദർശി - കടന്നുകാണാൻ കഴിവുള്ളവൻ 18. #ഗാർഹികം - ഗൃഹത്തെ സംബന്ധിച്ചത് 19. #ഗർണണീയം - ഉപേക്ഷിക്കത്തക്കത് 20. #ജിജ്ഞാസു - അറിയുവാൻ ആഗ്രഹിക്കുന്ന ആൾ 21. #ദിദൃക്ഷു - കാണാൻ ആഗ്രഹിക്കുന്ന ആൾ The main aim of friendly psc channel is to providing free video classes for Kerala PSC aspirants.I have used some memory tricks to remember the main points.My memory tricks will definitely help you to remember the difficult points.

Назад
Что ищут прямо сейчас на
friendly psc клоков буран лилдер купить pompeo comedy video' приспособления для ручного фрезера Slowed music michelin 1 hrs Green screen гусли музыкальный инструмент купить แอปเปิ้ล Server heena reka mp3 download Olim haqida sid Code Эпохалка Тёплая панама сборака для ксс видеокарта amd